Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "add"

1. Please add this. inabot nya yung isang libro.

2. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

Random Sentences

1. I know things are difficult right now, but hang in there - it will get better.

2. Ang pagiging maramot ay hindi maganda lalo na kung may nangangailangan.

3. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

4. Hanggang gumulong ang luha.

5. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

6. Habang nagbabaga ang araw ay isinakripisyo ng misyunero ang abang buhay.

7. Cosecha el maíz cuando las espigas estén completamente maduras

8. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

9. Naglalakad siya ng mabagal habang naka yuko.

10. Sa mga malulubhang kaso, kailangan ng pagpapakonsulta sa espesyalista na dentista.

11. Hanggang kailan mo ako girlfriend? diretsahang sabi ko.

12. Nagpakitang-gilas si Jose sa pamamagitan ng mabilis na pagpasa ng bola.

13. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

14. Pagkatapos ng malagim na balita, natagpuan ko ang aking sarili na tulala sa kanyang kwarto.

15. Sa aming pagsasaliksik, nagkaroon kami ng maraming mungkahi upang mapabuti ang aming eksperimento.

16. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

17.

18. Today, Amazon is one of the world's largest online retailers.

19. Ang buhay ay isang mumunting paraiso lamang.

20. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

21. Sadyang mahirap ang pag-aaral ng calculus.

22. The bird sings a beautiful melody.

23. Las hojas de los cactus son muy resistentes y difíciles de cortar.

24. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

25. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

26. Nasaan ang Katedral ng Maynila?

27. Madalas na mayroong propaganda sa panahon ng digmaan upang mapalawak ang suporta ng mamamayan.

28. Television is one of the many wonders of modern science and technology.

29. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

30. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

31. Instagram is a popular social media platform that allows users to share photos and videos.

32. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

33. Nagliliyab ang mga damo sa bukid dahil sa sobrang init ng panahon.

34. Hindi lang nila naririnig kundi nakikita pa ang katuwaan ng lahat.

35. Les enseignants peuvent organiser des activités parascolaires pour favoriser la participation des élèves dans la vie scolaire.

36. Nogle helte går frivilligt ind i farlige situationer for at redde andre.

37. I love the combination of rich chocolate cake and creamy frosting.

38. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

39. Ang India ay napakalaking bansa.

40. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

41. Magkaiba ang ugali nila, si Amparo ay tamad at walang kinagigiliwang gawin kundi ang lumapit sa mga bulaklak at amuyin ito.

42. Actions speak louder than words

43. Nabigla ako sa tanong nya kaya sinapak ko sya.

44. Sino ba talaga ang tatay mo?

45. Pupunta ako sa Germany sa susunod na taon.

46. The company's acquisition of new assets will help it expand its global presence.

47. Kung walang panget, walang pagbabasehan ng ganda niyo!

48. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

49. Mahirap mahalin ang isang taong mailap at hindi nagpapakita ng tunay na damdamin.

50. When we forgive, we open ourselves up to the possibility of reconciliation and rebuilding damaged relationships.

Similar Words

daddyaddressaddictionAdditionallyadditionAdditionally,adding

Recent Searches

conectanaddtuktokpanggatongkalupimagkikitamababasag-ulogayundinnegosyantevedvarendepaceexpeditedetsynag-emailnakadapasourcescapitalistnamularebolusyonbunsodistanciakaninonagtatakbonakabaonmakaiponseryosongpublicitynamachavitkumidlatbitawanmalayangnitotapatpunsobaroorderinelectoralitinanimreportnagpakilalafestivalesinatakeluislearninginventadohinahaplosmagtipidkasabaylumiwanaghumalopyestawifiminerviecontent,nararamdamansilid-aralancompaniesnatinagnapilidiyaryomagsisimularegulering,nanangisritwalpinalutodilimbagyobinibinibalingbroughtgrewmaestronakasandigdisenyongnanahimiknagsisigawnagandahanalas-diyeshinipan-hipannakatuwaangmagpapabunotbabaeumiinompakakatandaannagkasakitmagdamagandoble-karanapatayopinagbigyanpagtawapaghaharutanpalapagmaglalakadnalalaglagnangangahoynakabulagtanggabi-gabiposporomakikipag-duetoi-marknatulakmariansupilingiyerabuwenasipinatawagmagsunogusuarionanalosiksikannanunurijejusistemasiilanunanhirampasasalamatbalitapakibigyannawalanaantigpaalambintananilaosniyobinabaratkumantabagamatparaangbasketballpumikitconvey,roofstockminabutinangingitngitpresencehelenakanilahihigitsumasakaykaraokebinawiantasakunwaimbeskutodmamarilbutasmisteryotinapaynayonbulakdikyamvetohveriniintayambagcharismaticmayamangcarrieseducatingtiniodangerouskrusbeginningstseiconichumbleipantalopfamenanghahapdilendingjoebilugangfar-reachingskypesoccerpaghingiwaritransmitsdahandemocratictinulak-tulakbiggesticonurisaringipinikitsinongdetpedropersonalchefspeechhitauthorinterpretingresultlabanan