Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "primer"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Random Sentences

1. Algunos animales hibernan durante el invierno para sobrevivir a las bajas temperaturas.

2. Mabuti na lamang at nandyan ang kanyang kaibigan.

3. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

4. Pinagmasdan ko sya habang natutulog, mukha syang anghel...

5. The management of money is an important skill that can impact a person's financial well-being.

6. The scientific community is constantly seeking to expand our understanding of the universe.

7. The king's role is often ceremonial, but he may also have significant political power in some countries.

8. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

9. The team captain is admired by his teammates for his motivational skills.

10. Tumayo na ko tapos pumasok sa kwarto ko.

11. The company launched a series of new products, targeting different customer segments.

12. Sa mga panahong gusto kong mag-reflect, pinapakinggan ko ang mga kanta ng Bukas Palad.

13. Sa tuktok ng puno, natatanaw ko ang malawak na sakop ng kagubatan.

14. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

15. Hindi ako mahilig kumain ng pulotgata dahil sa sobrang tamis nito.

16. Bawat galaw mo tinitignan nila.

17. Les étudiants ont accès à des ressources pédagogiques en ligne pour améliorer leur apprentissage.

18. Inalok ni Maria ng turon si Clara.

19. Nag re-review si Gina para sa darating na board exam.

20. Tumango ako habang nakatingin sa may bintana, Ok. Sige..

21. Agradezco profundamente tu dedicación y esfuerzo.

22. Napakahusay nga ang bata.

23. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

24. Dumating siya mula sa Bikol kahapon ng umaga.

25. A couple of friends are coming over for dinner tonight.

26. Ayos lang. Basta alam kong safe kang nakauwi.

27.

28. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

29. Repeated frustration can lead to feelings of hopelessness or helplessness.

30. Ang labi niya ay isang dipang kapal.

31. We have been painting the room for hours.

32. Ang pagkakaroon ng positibong pananaw ay makatutulong sa pagharap sa mga hamon ng buhay, samakatuwid.

33. Sama-sama. - You're welcome.

34. The police were trying to determine the culprit behind the burglary.

35. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

36. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

37. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

38. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

39. Hindi ka niya kayang lokohin dahil alam niya ang kaibuturan ng iyong mga motibo.

40. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

41. Namangha ang lahat nang magdilim ang langit at gumuhit ang matalim na kidlat.

42. Lumiwanag ang aking puso sa simpleng "salamat."

43. Twinkle, twinkle, little star.

44. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

45. Diyan ang bahay ni Mr. Marasigan.

46. Saan pupunta si Trina sa Oktubre?

47.

48. Let's not ignore the elephant in the room any longer and confront the issue head-on.

49. It is an important component of the global financial system and economy.

50. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

Similar Words

primerasprimeros

Recent Searches

orugaprimerformagaanomagdaisinuotkisapmatapamilyangeffectsmarketinghinabaunattendedbinililumitawpaghusayanamingadmiredleahpinag-aralanmakawalakumukuloperopuedenlalabhannagc-crave1940turontechnologiessalu-saloniyabayangnapatakbokinatatalungkuanglibertarianusopinamalagiuulaminwordstrackconditioningbutinamannanaloricopagdukwangbumalingnakakagalingkawalanspaghettijacky---magbabalaindennakauslingkalakingakinevolvemakuhamaligayatumirainteractnahihiyangdaangreserbasyonboyfriendmalezaculturessugatangnakakaanimbabasahinawitinnochekailanmayabangyourself,thingstrenrestnahulitinulungansonperfectganamagtanghalianinspirationmenosnaglakadgowntokyohalagamakapagsabibobotokamustasikiptagtuyotbutihingrubberbaryodeveloptumikimknightnagkalapitmulpedenanghihinamadestudionapapikitjamestakotmenuuugud-ugodcallingkumaripaspaninginliableactualidadbulaklakkatipunandahanrolepinag-usapantamamag-uusaptennamulattumayoilankaliwatatawaglamanbarnesinyopanonoodgreatlybulsabanggainmagugustuhantilpinadalapuedekulturreplacedikinabubuhaypagtiisanfurbuenabusyangtahanandesign,halu-halopangyayarinagpepekebinitiwanfaultsakayisang1960sproducts:matamannapapansinmakilalalumakadhihigitso-calledmayamangvetowaternakukulilimagpakaramiabenamusicprovidedlandassaancompostelapaghihingalodamdaminlasingpamamagitancrazysumayawyou,nanghuhulidaratinghinanapinalalayanipanlinisisinusuotbrasokaninofatiskostandpromiseriyanperaaralbipolarsinkgermanyallowing