Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "primer"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Random Sentences

1. Bawat pook ay may kanya kanyang alintuntunin.

2. Dahil sa sipag at determinasyon, nakamit ni Michael ang tagumpay.

3. Limitar el consumo de alimentos procesados y azúcares añadidos puede mejorar la salud en general.

4. Mabilis siyang natutunan ang mga bagong teknolohiya dahil sa kanyang natural na abilidad sa kompyuter.

5. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

6. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

7. To infinity and beyond! at binaba ko ulit yung telepono.

8. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

9. Ang bagal mo naman kumilos.

10.

11. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

12. Kung walang panget, walang pagbabasehan ng ganda niyo!

13. Twinkle, twinkle, little star.

14. Lack of progress or slow progress towards a goal can also be a source of frustration.

15. The library has a variety of books to choose from, ranging from classics to modern literature.

16. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

17. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

18. Unti-unting gumuhit ang ngiti sa mga labi niya.

19. The cough syrup helped to alleviate the symptoms of pneumonia.

20. Nasa ilalim ng silya ang payong ko.

21. Binati niya ito ng "Magandang umaga sa iyo".

22. Makinig ka sa 'king payo pagkat musmos ka lamang.

23. Dime con quién andas y te diré quién eres.

24. Mi temperatura es alta. (My temperature is high.)

25. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

26. Ang arte. bulong ko sa may batok niya.

27. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

28. Nasa Cebu si Trina sa Disyempre?

29. Excuse me lang, anong mga kulay ang mayroon?

30. She is playing the guitar.

31. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

32. Ikinagagalak kong makilala ka, Maria.

33. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

34. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

35. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

36. Ang calcium ay kailangan ng ating katawan upang tumibay pa ang buto.

37. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

38. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

39. Sa paligid ng balde, nakikia niya ang kanyang anino.

40. Sa kabila ng mahigpit na bantay, nangahas silang tumakas mula sa kampo.

41. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

42. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

43. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

44. The management of money is an important skill that can impact a person's financial well-being.

45.

46. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

47. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

48. The culprit responsible for the car accident was found to be driving under the influence.

49. Nasa Ilocos si Tess sa Disyembre.

50. Gusto ko na po mamanhikan bukas.

Similar Words

primerasprimeros

Recent Searches

primeromelettenasabingkapagpinagtagpobinigaykalalakihankasawiang-paladrevolucionadohumalakhakpinakamaartengsinundangpakakatandaannapakalusoggovernmentmedikalpagkagustonalugmokpagtutolmagtataasgumagamitunattendednandayamakikikainnegro-slavesbloggers,pinakabatangnagkasunogpagdukwangpagkakalutopaga-alalakarwahengobservererpinapakiramdamanmagkitaperopinyuanfeedback,adgangmanahimikbalediktoryankayabanganmagbalikpawiintv-showspagbabayadmakauwimasasayapambatangnakahugminatamismarasiganpabulongnapahintomagamotpumulotuniversityisinuotsenadorpagtatakahulihansasakayhimselftilaisubolumahoknatatanawtalinovictoriakabighanaantigumiwasmagpakaramirewardinghirampinangaralanafternoonnagpasamabahagyangpromiseconclusion,isinamariegafolloweddyosakoreanauntogdescargarhinagisfavorkainisexperts,natuloybagongnagdaoscocktailperwisyobunutandalawinpangakoretirarwondermatabangdalhanmaistorbodeletingpagputinetflixsandaliphilippinepinagkasalananbumilimatayogrestawranmaisipsangkapkamibingbingplasahappenedbecamenakakumatokkuyamatulisuntimelyshineskapaintamariseroonbakaconditioningkikonunobilaotanodpalagipasalamatanaumentarcomputere,yarinag-replykelanangkanpublishinggotparusalarawanaudio-visuallyprofessionalagospangulotomarrosedeathfireworkspaybluelimosfertilizerpagkababaeveningcreationstuffedarmedcomunesteamrolledshapingidea:encounterbilersatisfactiontwitchcontinueworkshoptiptwoyeahpasinghalquicklypuntastopprotestacommercemuchrevisefacultycreativelolawaringmalezamitigatehitikipinabalotpigilanpansamantalapagpili