Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "primer"

1. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Random Sentences

1. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

2. En invierno, la contaminación del aire puede ser un problema debido a la calefacción en interiores y a la menor circulación del aire exterior.

3. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

4. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

5. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

6.

7. Cada año, la cosecha de manzanas en esta región es muy buena.

8. Napakaseloso mo naman.

9. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

10. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

11. Walang mangyayari satin kung hindi tayo kikilos.

12. Malikot ang kanyang mga mata nang siya'y bumangon at itukod ang mga kamay sa semento.

13. Under fødslen går kroppen gennem en intens og smertefuld proces.

14. The concept of money has been around for thousands of years and has evolved over time.

15. The king's court is the official gathering place for his advisors and high-ranking officials.

16. Nalaki ang mga mata ni Mica sa sinabi ni Maico.

17. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

18. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

19. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

20. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

21. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

22. Más vale tarde que nunca. - Better late than never.

23. Tumango siya tapos dumiretso na sa kwarto niya.

24. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

25. Nag-iyakan ang dalawang batang sina Maria at Jose.

26. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

27. She has been running a marathon every year for a decade.

28. It's nothing. And you are? baling niya saken.

29. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

30. Nagpaluto ang nanay ko ng adobo sa akin.

31. Las hojas de las plantas de té deben secarse correctamente para obtener el mejor sabor.

32. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

33. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

34. Sa panghihiyang ginawa ni Kablan, gumanti ang pobreng matanda.

35. My son drew a picture of a pretty lady with a big smile.

36. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

37. Celles-ci comprennent la thérapie, le conseil et les groupes de soutien.

38. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

39. Pumupunta ako sa Negros tuwing Abril.

40. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

41. The computer works perfectly.

42. Ito ang tanging paraan para mayakap ka

43. I've got a big presentation at work today - I hope I don't break a leg!

44. Nagustuhan kita nang sobra, kaya sana pwede ba kita makilala?

45. Ang alon sa karagatan ay malakas ngayon dahil sa bagyong dumaan.

46. Gusto kong ibigay ang aking buong atensyon sa aking nililigawan upang malaman niya na tunay kong mahal siya.

47. Su vida personal fue complicada y difícil, a menudo luchando con la depresión y la soledad.

48. Pumupunta siya sa Amerika taun-taon.

49. Ano ang palitan ng dolyar sa peso?

50. May dalawang puno sa harap ng bahay namin.

Similar Words

primerasprimeros

Recent Searches

primercommunicationsdolyarpracticadoflexible10thboteworkdayfertilizerrolledpopulationmatchingchavitbandangpresleykamalayanmulienterneromatandaelectedsummitburdenprovesaringoverumiilingcongratssipasacrificelumabasdingdingrecentmotionaidstreaminghoweverrestinfluencesurgerypartnermontreallovedistancekamakalawaipinalutoheftyfuelmenuscaleamounttoolmultocommercedraft,nutsnegativemadadalamarahascoinbasebaliknaliligoremoteremembertipelectallowsbilingcallinginterviewingquicklycomunicarsedidingfalldoingcurrentworkshopinteractcertainevolvelutuinstructurepunongkahoyaffectcardiganpagbabasehaneducatingdi-kawasadesigningwatchingstrengthitongsigningsmanggapasyalantaong-bayanpagtutolpagsayadkarnabalpagiisipstartedbituinprogramming,continueprocessdatapaghingipatricklearningpaghamakmaipapautangmatapobrengpakanta-kantangnapaluhamagagawanahihiyangangelanapadpadkalikasannapadaminanatiliydelsernanaisinjemilasinggeronagbungabalitamillionsnapakamisteryosoinisipmatangosbungadmarmaingnagsalitamasasamang-loobmanatilimakatawakumakapitcryptocurrency:maibalikbumibitiwmahinangmaglinismatarayiyongmensahenanalorevolutionizedmapuputimagitingmaagapannagkakasayahantungkolcommunitylumangoynakapasalumamangmakapanglamangmaghaponglumakingrightsfinalized,langostanaglokohannagdabogkinalilibingankagubatanmarketing:kumidlatuniquekakaroonkinagigiliwangkapatidsukatinflamencoempresasipinagdiriwangeffectemphasisgayundinreleaseddiyosangcramehinamakbinge-watchingdealdivisiondeletingpinabulaanangnungdakilangcontent:flyvemaskinerpagkakilanlantulongumuwingtingingsampunghalinglingnapagsilbihan