Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "leukemia"

1. Leukemia can affect people of all ages, although it is more common in children and older adults.

2. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

3. Leukemia can be caused by genetic mutations or exposure to certain chemicals or radiation.

4. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

5. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

6. Leukemia is a type of cancer that affects the blood and bone marrow.

7. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

8. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

9. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

10. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

11. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

12. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

13. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

14. The patient's doctor recommended a treatment plan based on the type and severity of their leukemia.

15. The patient's family history of leukemia increased their risk of developing the disease.

16. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

17. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

18. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

19. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

20. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

Random Sentences

1. Ang Ibong Adarna ay may tatlong kapatid na naghahangad na maagaw ang mahiwagang ibon para magamit sa kanilang sariling kaharian.

2. Ayaw ko ng masyadong maanghang/matamis.

3. Si Chavit ay may alagang tigre.

4. The app has also become a platform for discovering new music, with songs going viral through TikTok.

5. Dahil sa maayos na pamamahala, yumabong ang ekonomiya ng bansa.

6. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

7. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

8. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

9. Saan ba? Wala naman ako allergy eh, palusot ko lang.

10. Ang sugal ay isang hindi makabuluhang pamumuhunan na madalas nawawala ang ininveste.

11. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

12. Medarbejdere skal ofte undergå årlig evaluering af deres præstation.

13. Napatungo ako dahil nangingilid na naman ang mata ko.

14. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

15. Hindi ako makahinga nang maayos kaya nanghina ako at nag-halinghing nang malalim.

16. Hindi dapat tayo sumuko sa agaw-buhay na laban sa kahirapan.

17. Ang poot ay nagiging tagapagtanggol ko sa sarili ko, isang apoy na umaalab sa aking loob upang ipagtanggol ang aking pagkatao.

18. Nakuhang muli ang gong at nagkaroon pa ng punong may matamis na bungang hugis kampana ang mga taong-bayan.

19. Mathematical formulas and equations are used to express relationships and patterns.

20. Size 6 ang sukat ng paa ni Elena.

21. "Dog is man's best friend."

22. I am teaching English to my students.

23. Nakarinig siya ng tawanan.

24. Kumikinig ang kanyang ulo at nangangalit ang kanyang ngipin.

25. Ang bilis ng internet sa Singapore!

26. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. Sa panahon ng krisis, mahalagang magtulungan ang bawat isa, samakatuwid.

29. Nakakain ka na ba ng prutas na durian?

30. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

31. Me duele todo el cuerpo. (My whole body hurts.)

32.

33. All these years, I have been creating memories that will last a lifetime.

34. Ang malambot na lilim ng ulap ay nagbigay ng kakaibang kulay sa silong ng buwan.

35. Sa pagdiriwang ng fiesta, ang bayanihan ay nagiging mas makikita sa paghahanda at pagdaraos ng mga aktibidad.

36. A couple of lovebirds were seen walking hand-in-hand in the park.

37. Kung may isinuksok, may madudukot.

38. Hiram lamang natin ang ating buhay sa Diyos.

39. Ang palay ay hindi bumubukadkad kung walang alon.

40. Es un cultivo versátil que se puede utilizar para hacer alimento para humanos y animales, y también se utiliza en la producción de biocombustibles

41. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

42. Bakit hindi? ang natigilang pagtatanong ni Mariang Maganda habang pinagmamasdan ang malungkot na mukha ng prinsipeng kanyang iniibig.

43. The film director produced a series of short films, experimenting with different styles and genres.

44. Una mala conciencia puede llevarnos a tomar malas decisiones.

45. Ano bang pinagsasasabi mo jan Kuya?

46. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

47. She admires the beauty of nature and spends time exploring the outdoors.

48. Madali naman siyang natuto.

49. The grocery store offers a variety of fresh produce, including fruits and vegetables.

50. Nagsusulat ako ng mga pangungusap sa papel upang ma-praktis ang aking bokabularyo.

Recent Searches

leukemiamakabawiumagangferrernabuhaynakapilaramdamadverselyitinulosnakukuhaipinamerlindainiresetahitaangeladalawangpatakbongcorporationdistanciashoppingnaiiritangbutimapzebravidtstraktkaagawvaliosaipanlinismighttaposnagsisipag-uwiansinenalugodhitmini-helicoptercigarettegandapampagandaviewspaparusahanbestbusogchadmansanasutilizarpocauntimelysabognagmadalingsaberreservedclientebiglasinceavailablenapakamotbesespansinduritsaadiferenteskadalagahangvehiclesasiaartistastaxitransportnakatirangstoryprodujomaliksicombatirlas,nabalitaanvitaminnaiisiprenacentistaanabutonagawangbulalasnegosyantebuhawijenysaidimportantesnakapagngangalitanoleadingnakarinigbarcelonamasayahinkaraokeusobwahahahahahadispositivosarapnatutuwasongmahinangkare-karemalulungkotpeterhulinginteractmagpa-checkupautomatiskvisualcompositoresconnectionmagnifybroadcastmanahimikoutlinestrategiesclocklumbayinangfridaykomedorarbularyotumatawagiiklidomingonatuyomatandanghangaringindependentlyhinihintayanihinconvertidasagilaparusahanhinatidgiraywalongsemillasmagagandangtapatpambatangtinutopgatoluminommapagripobinuksanmayonatitiyakbinanggacocktailomfattendepisarapagpalitnalalaglaghalamanpalaykaybilisorganizemaulitanibersaryoinantaytagaytayeclipxecoatfacilitatingmagtakatrafficmalapadasahanbarongtinanggalgawainnakayukoatensyondiyaryomakapagsabiknowblazingnakauslingpagsalakaynagtalagamakikipag-duetofurthernagbiyahenogensindepamagatmakapasavaledictorianremotebangmababangisnakatindigakalamumuraedadsolarumiinomyumuyukomagsungitkinikilalangathena