Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "leukemia"

1. Leukemia can affect people of all ages, although it is more common in children and older adults.

2. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

3. Leukemia can be caused by genetic mutations or exposure to certain chemicals or radiation.

4. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

5. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

6. Leukemia is a type of cancer that affects the blood and bone marrow.

7. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

8. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

9. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

10. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

11. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

12. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

13. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

14. The patient's doctor recommended a treatment plan based on the type and severity of their leukemia.

15. The patient's family history of leukemia increased their risk of developing the disease.

16. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

17. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

18. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

19. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

20. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

Random Sentences

1. Magkano ang arkila ng bisikleta?

2. El que mucho abarca, poco aprieta.

3. Sa ganang iyo, mahalaga ba talaga ang pagkakaroon ng mataas na grado sa eskwelahan?

4. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

5. Nagliliyab ang apoy sa kagubatan, kaya't mabilis na kumalat ang sunog.

6. The cake you made was absolutely delicious.

7. Doa adalah upaya komunikasi seseorang dengan Tuhan atau kekuatan yang lebih tinggi.

8. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

9. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

10. Bilang paglilinaw, hindi ako sumang-ayon sa sinabi niya, ngunit iginalang ko ang kanyang opinyon.

11. If you think I'm the one who broke the vase, you're barking up the wrong tree.

12. Einstein was a member of the NAACP and spoke out against racism in the United States.

13. Emphasis can be used to persuade and influence others.

14. This has led to increased trade and commerce, as well as greater mobility for individuals

15. Mathematics is an ever-evolving field with new discoveries and applications being made constantly.

16. Maaaring magdulot ng sakit sa kalooban ang mga dental problem, kaya't mahalagang agapan ito upang maiwasan ang mas malalang kalagayan.

17. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

18. Tumango ako habang nakatingin sa may bintana, Ok. Sige..

19. Actions speak louder than words.

20. Isang araw nagkasakit si Aling Rosa.

21. Kapag sumabog ang mga salot ng droga, hindi lamang ang tao ang nasasaktan, pati na rin ang buong pamilya.

22. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

23. Ang kanilang pagmamahalan ay animo'y walang hangganan, kahit sa anong pagsubok na dumaan.

24. Ilang termino na syang nagsisilbi bilang mayor ng kanilang lungsod.

25. Ikinukwento niya ang mga masasayang alaala ng kanyang kabataan na ikinalulungkot niyang wala na.

26. Sa pagsasaayos ng paaralan, ang bayanihan ng mga guro at magulang ay nagdulot ng magandang resulta.

27. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

28. Kelahiran bayi adalah momen yang sangat penting dan dianggap sebagai anugerah dari Tuhan di Indonesia.

29. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

30. Pumila sa cashier ang mga mamimili nang limahan.

31. Kung sino ang maagap, siya ang magandang kinabukasan.

32. Selamat jalan! - Have a safe trip!

33. The momentum of the athlete propelled him across the finish line.

34. Eine hohe Inflation kann das Vertrauen der Menschen in die Wirtschaft und die Regierung verringern.

35. Hihiga na sana ako nang may kumatok sa pinto.

36. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

37. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

38. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

39. Ako'y lumilipad at nasa alapaap na.

40. Si Teacher Jena ay napakaganda.

41. Mabuti naman,Salamat!

42. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

43. Inakalang hindi siya karapat-dapat, pero siya ang napiling lider.

44. I've got a big presentation at work today - I hope I don't break a leg!

45. Ang mga matatamis na melodiya ng kundiman ay nakakapukaw ng damdaming umiibig.

46. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

47. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

48. Nahigitan na nito ang kakayanan ng kanyang ama at ina.

49. Eh what's the big deal ba? Parang kasama lang kahapon eh.

50.

Recent Searches

leukemiatumaposfitratetvscocktailincidencepumupuntagirlfriendmarielincrediblelabasreorganizingmoodbaguiomahahabangelectmartianmagagamitsuotthingsconectadosnagpanggapkumikilosbalediktoryankumaripasgayundinumangatmatabamaranasanindustriyagumigisingpicssisterarturonapatakbopinagkiskismahiyaawitinpagbigyankolehiyodatiexpresane-commerce,limangtangingrelyngingisi-ngisingmaistorbonaabotpagdidilimfuncionarbitbitsundaealapaapwordmamijudicialmisteryosumasayawdanzawidelynagtatakboreaksiyonsumisidenhederforskelmaulitsiniyasatbigassumalaminatamismaibabalikamendmentdecreasekagabigoodeveningmag-alalagitarautak-biyalilybighanitransportnagtrabahopakistanhighestrobertmagtataasspindlesakinnamataymatapangflyvemaskinerbakantetuvonapaagatinangkamaghilamostiniklingfiverrbumabapeksmanabutanawaunossofapopcornmagpuntaumokayrawautomationteachingsmrsmanakbonatutokbilihastafeedback,thankbasketbolmalezalaamangseasonmindanaopagka-datudanmarksharmainecasaphilippinemarasiganwatawatmapa,pansolsitawinstrumentaldondekuneyumabongdurasomelettegisingkaugnayannyehelpedangkopnagtagalsorrymasdanpagtutolpagsayadkalalakihanbotopakisabiknowledgeformsnapapalibutanfuncionesnakabulagtangpakaininnakangisinagmumukhadisenyongsoonmaliitkulaynanlilimahidnagsulputanmasaksihanbehindnaibibigayheresapatossinonginiinomlightsbiroeskwelahangustopayinteligentesstatingmagkasinggandaroquedahan-dahanpulongipinamilikinamumuhiande-dekorasyonmagsasalitabillpinalitankaguluhananaksumalakaysaktanchecksrespektivenagtakalahatiniintay