Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "well"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

3. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

4. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

5. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

6. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

7. Bitcoin is the first and most well-known cryptocurrency.

8. Butterfly, baby, well you got it all

9. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

10. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

11. Football players must have good ball control, as well as strong kicking and passing skills.

12. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

13. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

14. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

15. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

16. Proper training and socialization are essential for a well-behaved dog.

17. Regular exercise and playtime are important for a dog's physical and mental well-being.

18. The athlete's hefty frame made them well-suited for their position on the team.

19. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

20. The eggs are beaten until the yolks and whites are well combined.

21. The exam is going well, and so far so good.

22. The management of money is an important skill that can impact a person's financial well-being.

23. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

Random Sentences

1. Nahulog ang saranggola sa puno ng mangga.

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

3. "Love me, love my dog."

4. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

5. Ang paggamit ng droga ay hindi lamang nakakapinsala sa kalusugan, kundi pati na rin sa kabuuang pagkatao.

6. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

7. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

8. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

9. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

10. Sino-sino ang mga nagsibili ng mga libro?

11. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

12. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

13. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

14. Maraming tao sa tabing-dagat sa tag-araw.

15. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

16. Cut to the chase

17. Las labradoras son perros muy curiosos y siempre están explorando su entorno.

18. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

19. El arte puede ser utilizado para fines políticos o sociales.

20. The artist's intricate painting was admired by many.

21. The app has also become a platform for discovering new music, with songs going viral through TikTok.

22. Ano ang mga apelyido ng mga lola mo?

23. L'argent est un élément essentiel de notre vie quotidienne.

24. Ultimately, a wife is a partner and equal in a marital relationship, contributing to the success and happiness of both spouses.

25. Hindi ibibigay ng Panginoon sa iyo ang isang pagsubok kung hindi mo ito kaya, magtiwala at maniwala ka lang sa Kanya.

26. My girlfriend looked like a beautiful lady when she walked down the stairs in her new dress.

27. Naglaba ang kalalakihan.

28. The momentum of the athlete propelled him across the finish line.

29. The new factory was built with the acquired assets.

30. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

31. Kumain ako ng macadamia nuts.

32. Saan itinatag ang La Liga Filipina?

33. Masyadong mahal ang pagkain sa hotel.

34. Con paciencia y dedicación, se puede disfrutar de una deliciosa cosecha de maíz fresco

35. Excuse me, may I know your name please?

36. Anung oras na ba? bakit hindi pa kayo naalis.

37. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

38. Hindi ako nakatulog sa eroplano.

39. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

40. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

41. Ngayon ko pa lamang nakita ang halaman na ganito.

42. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

43. Sinabi umano ng saksi na nakita niya ang suspek sa lugar ng krimen.

44. Basta may tutubuin ako, lahat ay areglado.

45. Kailangan nating magpakatotoo sa ating mga nararamdaman, samakatuwid.

46. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

47. Les patients peuvent avoir besoin de soins palliatifs pendant leur hospitalisation.

48. Inflation kann dazu führen, dass Unternehmen Schwierigkeiten haben, Kredite zu erhalten.

49. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

50. Ang tamang dami ng pagtulog ay nakakatulong sa pagpapalakas ng immune system.

Recent Searches

trafficrhythmcallermarchroboticsinongwellmoodsumasambanaguusapitimcandidatedositloglaterhardbarpresspublishingtruefatalbusprogramaevolvedbituinhulingquicklyuniquequeedit:salapinapilingaggressionallowednariningrenepinipilitmabangongmensahenabalitaanbenefitskarapatangcondonagawangmanatilinakaangatvitaltutoringmanahimiktagaytaynabasainaabotpinag-usapannanaogatensyongnagpasamanauntogaraw-pagigingbarcelonabiglaanartepag-asaclasesstudenttawananindependentlybumuhosbestidahouseholdyouorganizevehiclesngaunaninakalaappcigaretteilangabingotromaglalakadnagsusulatpakikipagtagponakakunot-noongpagkakatayonakapamintanabook:taga-hiroshimahurtigerenagmamadalimaihaharappinakabatangmanggagalinggayunmanpaglalayagnagpapakainkalakihanpagngitinakalilipastatawagmerlindabumibitiwpaki-drawingrebolusyonkaharianmagbayadsasagutinkinakabahannakikiahumiwalaynakangisiinsektongpanghihiyangfitnesspinapataposgovernmentnapapahintonecesarionalalabingsinaliksikkissmagagawanandayabisitanakapasautilizanpagbibiroshebintanatodaspassworddulotbranchlabasmagsabiabundantepaghanganaiilangtaglagasculturaskahongmabatongumiibigtumatawadkidkirantotoongumakbaymaibabalikkailanganbighanidamdaminpaglingonsubject,iligtasmabagalpinangaralanhawakpropesorsangadalawangrimaspaakyatkaninanangingilidipinambilimoneymabigyanmaibalunasaayusinbaguiopokerpulonglupaintiboksementonapasukocurtainstatlongcoughingrecibirlender,bumilideletingtalagalipatgagambacarolnapapikitkutodandoyipagmalaakicocktailmaalwangtumaposamerikapumatolpatiparo