Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "well"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

3. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

4. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

5. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

6. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

7. Bitcoin is the first and most well-known cryptocurrency.

8. Butterfly, baby, well you got it all

9. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

10. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

11. Football players must have good ball control, as well as strong kicking and passing skills.

12. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

13. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

14. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

15. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

16. Proper training and socialization are essential for a well-behaved dog.

17. Regular exercise and playtime are important for a dog's physical and mental well-being.

18. The athlete's hefty frame made them well-suited for their position on the team.

19. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

20. The eggs are beaten until the yolks and whites are well combined.

21. The exam is going well, and so far so good.

22. The management of money is an important skill that can impact a person's financial well-being.

23. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

Random Sentences

1. Las labradoras son excelentes perros de trabajo y se utilizan a menudo en búsqueda y rescate.

2. It’s risky to rely solely on one source of income.

3. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

4. Sobra. nakangiting sabi niya.

5. We have cleaned the house.

6. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

7. Sa aling bahagi ng pelikula ka natawa?

8. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

9. Ang pelikula ay ukol kay Jose rizal na lumaban para sa kanyang bayan.

10. I am not planning my vacation currently.

11. Ang sigaw ng matandang babae.

12. "The better I get to know men, the more I find myself loving dogs."

13. Masaya ang pakanta-kantang si Maria.

14. Gusto ko na mag swimming!

15. The company used the acquired assets to upgrade its technology.

16. Masamang droga ay iwasan.

17. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

18. Sa palagay ko, pangit ang kotse ng tiyo ko.

19. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

20. Binigyan ng pangalan ng Apolinario Mabini ang isang bayan sa Batangas.

21. Nakarating kami sa airport nang maaga.

22. Los blogs y los vlogs son una forma popular de compartir información en línea.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

25. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

26. Bunso si Bereti at paborito ng ama.

27. Sino ang maghahatid sa akin sa pier?

28. Ipinagbabawal ang paglapastangan sa mga pampublikong lugar tulad ng mga museo at bibliyoteka.

29. The river flows into the ocean.

30. Maganda ang bansang Singapore.

31. Huwag na sana siyang bumalik.

32. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

33. Binigyan niya ako ng isang dosenang rosas.

34. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

35. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

36. Dahil sa pangyayaring ito, mas lalong natakot ang mga taong bayan na lumapit sa puno.

37. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

38. Bumalik siya sa Pilipinas nang biglaan dahil may emergency sa kanilang pamilya.

39. Napansin ng mga paslit ang nagniningning na baston ng matanda.

40. Sa gitna ng kaniyang pag-aaral, napadungaw siya sa katabing silid at nakita ang kanyang kaibigan.

41. Sa pagguhit, mahalaga ang pagpili ng tamang kasangkapan tulad ng lapis, papel, at krayola.

42. May anak itong laging isinasama sa paglalaba.

43. The charitable organization provides free medical services to remote communities.

44. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

45. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

46. The waveform displayed on an oscilloscope can provide valuable information about signal amplitude, frequency, and distortion.

47. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

48. Oh.. hindi ko alam ang sasabihin ko.

49. Women have been leaders in social justice movements, such as the civil rights movement and the women's suffrage movement.

50.

Recent Searches

saringwellarmedbehalfbabesufferanupresidentialnaglabananmasknaguusapnakitulogpinapaloeconomysiyasecarseprodujoenglishatadividesmitigatenagsuotremoterepresentativekwenta-kwentakulaysolidifyrangemusiciansregulering,gatoldeleleadingayannamanboyfriendsampaguitakunwa1940librofatanumangbringtapejacepinagtagpomagpa-picturenamumulaklaknagbabakasyonspiritualnakagalawjoyikawhumblenagtatamposinehankahirapanpangungutyamang-aawitpinagalitannakakabangongayunmanikinakagalitmarketplacesmanlalakbayressourcerneleegmaputicellphonenakapaligidfriendpamilyamagpakaramieditdilagmalakitungawpagpapautangnawalanginirapanentrancenakatiranglumiwanagbloggers,pagkapasoknatingalapamanhikanpaga-alalamarketingipinatawagalapaappracticadomiyerkuleskommunikererkapintasangcualquiermasasayamagdamaganpaglalabakilongpaghangababasahinpakikipagbabagpagsisisipagtataaskumikilosnaabutannagmistulangpagmamanehodiferenteshampaslupauugud-ugoddoble-karanagreklamotitatumatawagnakakatandahayaannakikitangpakakatandaanmoviepagkasabipagtingini-rechargenamatayiloilopinasalamataninombeginningresultareserbasyonsumalimurang-muranahulisinakopvillagehardpocapalabuy-laboymaranasantumatawadumikotnabiawangnapakabiliskagubatannearpasaherodiyanpundidootrasumiibigbuwenastumatakbodifferentpasasalamatnapawinaabotproducererkapatagansisikatsementongsusunodhumayocover,mismocombatirlas,vasquescleangabrielnamilipittsinaisinarakastiladescargarsuriinkassingulanguwakpagiisippiyanokindergartenunananongharingibabawupoinaapimulmensahemagpagalingsanakawili-wiligawasikatjulietbinawianundeniablehelenakusinanagbiyayagusali