Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "well"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

3. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

4. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

5. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

6. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

7. Bitcoin is the first and most well-known cryptocurrency.

8. Butterfly, baby, well you got it all

9. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

10. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

11. Football players must have good ball control, as well as strong kicking and passing skills.

12. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

13. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

14. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

15. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

16. Proper training and socialization are essential for a well-behaved dog.

17. Regular exercise and playtime are important for a dog's physical and mental well-being.

18. The athlete's hefty frame made them well-suited for their position on the team.

19. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

20. The eggs are beaten until the yolks and whites are well combined.

21. The exam is going well, and so far so good.

22. The management of money is an important skill that can impact a person's financial well-being.

23. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

Random Sentences

1. Pahiram ng iyong mga notepads at ballpen para sa aking meeting.

2. The telephone has also had an impact on entertainment

3. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

4. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

5. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

6. Siya ang aking pinakamatalik na kaulayaw sa opisina.

7. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

8. Las hierbas de té, como la manzanilla y la melisa, son excelentes para calmar los nervios.

9. Wala naman. I think she likes you. Obvious naman di ba?

10. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

11. Ang pagiging maramot sa kaalaman ay nagiging hadlang sa tagumpay ng iba.

12. Ang taong mapagbigay, sa kapwa ay may kapatid.

13. Inakalang ligtas ang lugar, pero may paparating palang bagyo.

14. A veces, la paciencia es la mejor respuesta ante una situación difícil.

15. Hindi dapat natin ipagkait ang mga oportunidad na dumadating sa atin, datapapwat ay hindi ito madaling makamit.

16. Ano na nga ho ang pamagat ng palabas ninyo?

17. Nagtitinginan na sa amin yung mga tao sa paligid namin.

18. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

19. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

20. He has been meditating for hours.

21. Gutom ako kasi hindi ako kumain kanina.

22.

23. Ang pagsisindi ng kandila tuwing gabi ay naging isang ritwal na nagbibigay ng katahimikan sa kanyang isip.

24. Naramdaman ko ang kalungkutan na unti-unti nang napawi nang matanggap ko ang magandang balita.

25. The United States has a system of government based on the principles of democracy and constitutionalism.

26. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

27. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

28. The surface of the football field can vary, but it is typically made of grass or artificial turf.

29. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

30. Mas lumakas umano ang ekonomiya matapos buksan muli ang mga negosyo.

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

33. Inirekomenda ng guro na magbasa kami ng maraming aklat upang mapaunlad ang aming kasanayan sa pagbabasa.

34. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

35. Ate Annika! Gusto ko yung toy! Gusto ko yung toy!

36. Gusto ko ang mga bahaging puno ng aksiyon.

37. Limitations are the boundaries or constraints that restrict what one can or cannot do.

38. No tengo palabras para expresar cuánto te agradezco.

39. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

40. The sun does not rise in the west.

41. Matagal ang pagluluto ng kare-kare.

42. Sa takip-silim, maaaring mas mapakalma ang mga tao dahil sa kulay at hangin na mas malumanay.

43. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

44. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

45. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

46. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

47. Iginitgit ni Ogor ang bitbit na balde at kumalantog ang kanilang mga balde.

48. Sa sobrang dami ng mga dapat gawin, may mga pagkakataon na naglilimot siya sa ilang mga mahahalagang mga takdang-aralin.

49. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

50. Lumalakad siya ngayon na walang-tiyak na patutunguhan.

Recent Searches

nangagsipagkantahanwellnakuhanagsusulatkinauupuankadalassundhedspleje,constitutionhonestomagbibigaymatapangveryika-50trainsarghtigasganidmagkasintahanpagsasalitanakabibingingdesign,parkingsurgerysumangparinnakakatawanaantiglittlepnilitexperts,kulayjudicialentertainmentbestidabagnanigasnagsinedalawamagbungapelikuladagat-dagatanlingidhalamankirotbagkus,mejomagtatagalfartabipagbibirosaanhagdananhinukaynatalongtienennalakijingjingpinapakainideyaakomamiearnkinikilalanghumiwalaypistapaglalabadamarangalkabiyakkantofactorespagkaraanharapalas-diyespisaramag-asawanitonamumulaklakrockhumihingitransparentpinagkiskispioneermatalimestilosrevolutioneretfreedomsmataaasdagokantoniobilugangnagbabakasyonnalamanlikodcruzyeymalungkotngumiwibalatigigiitfatmaongmahigpitdedication,humpaymasasabikasakitipapainitarbularyospecialhinagud-hagodpresyoairplanesnagmamadaliearlykinatatakutanindependentlyexigentenagsunurantinuturobook:yearalanganeconomiccarolsundaloproudiginawadasafeelpatakboparangmiratumatawagpakpaktalentsuriinrealgearipinadalanangangakowalangbuung-buokasiyahannabasanilimascrecerkasinggandamagtigiletsylastnotdipangwalkie-talkiehawaiiimportantekunepagtatakaskyldes,anilamagagandangtienemaipapautangnagngangalangwikaschooltulangpumupuritodasasodumatingbigyannatatanawalamgabipinangaralanhydelromeromahahawatumirakwenta-kwentasumakitmalumbaypagkokaksimbahankumitacrazynaritokatabingnakakapagpatibaykumatokhimiganak-pawisnalalaroabanganbawatinvitationnilaosanghelcnicosugat