Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "well"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

3. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

4. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

5. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

6. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

7. Bitcoin is the first and most well-known cryptocurrency.

8. Butterfly, baby, well you got it all

9. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

10. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

11. Football players must have good ball control, as well as strong kicking and passing skills.

12. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

13. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

14. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

15. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

16. Proper training and socialization are essential for a well-behaved dog.

17. Regular exercise and playtime are important for a dog's physical and mental well-being.

18. The athlete's hefty frame made them well-suited for their position on the team.

19. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

20. The eggs are beaten until the yolks and whites are well combined.

21. The exam is going well, and so far so good.

22. The management of money is an important skill that can impact a person's financial well-being.

23. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

Random Sentences

1. Nagkwento ang lolo tungkol sa multo.

2. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

3. Nagluluto si Andrew ng omelette.

4. Ilang tao ang nagpapaitim sa beach?

5. Huwag mong hiramin ang aking payong dahil umuulan pa rin.

6. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

7. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

8. Tumango siya tapos dumiretso na sa kwarto niya.

9. Emphasis can be used to provide clarity and direction in writing.

10. Television also plays an important role in politics

11. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

12. Gusto kong hiramin ang iyong cellphone para tawagan ang aking kaibigan.

13. Eine hohe Inflation kann die Wettbewerbsfähigkeit von Exporten verringern.

14. Sa lahat ng bagay, mahalaga ang tamang panahon.

15. Sa matinding takot ay nagsunuran ang mga mangingisda sa di nila nakikilalang matanda.

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. Scientific research has led to the development of life-saving medical treatments and technologies.

18. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

19. Investors can purchase shares of stocks through a broker or online trading platform.

20. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

21. George Washington was the first president of the United States and served from 1789 to 1797.

22.

23. Dette er med til at skabe en høj grad af social tryghed for befolkningen, og det er også med til at sikre, at Danmark har en lav arbejdsløshed

24. Sarado ang eskuwela sa Sabado at Linggo.

25. La realidad es a menudo más compleja de lo que parece.

26. Kinasuklaman ako ni Pedro dahil sa ginawa ko.

27. Siya ang pinuno ng rebolusyonaryong kilusan laban sa pananakop ng mga Espanyol.

28. Uy, malapit na pala birthday mo!

29. Det er vigtigt for samfundet at arbejde på at inkludere og respektere transkønnede personers rettigheder og behov.

30. Kailangan mong malaman kung sino ang mga taong bukas palad sa iyo upang hindi ka masaktan.

31. I woke up early to call my mom and wish her a happy birthday.

32. Nagdesisyon siyang mag-iwan ng trabaho upang magtayo ng sariling negosyo.

33. Inflation kann durch eine Zunahme der Geldmenge verursacht werden.

34. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

35. Los invernaderos permiten el cultivo de plantas en condiciones controladas durante todo el año.

36. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

37. Eine starke Gewissensentscheidung kann uns helfen, unsere persönlichen Werte und Überzeugungen zu verteidigen.

38. The song went viral on TikTok, with millions of users creating their own videos to it.

39. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

40. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

41. Inflation kann die Arbeitsbelastung der Zentralbank erhöhen.

42. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

43. Marahil ay mahirap para sa akin na magpasya sa ngayon.

44. Den danske økonomi er bygget på en kombination af markedsekonomi og offentlig regulering

45. Kailan at saan po kayo ipinanganak?

46. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

47. The actress on the red carpet was a beautiful lady in a stunning gown.

48. La calidad del suelo es un factor clave para el éxito de los agricultores.

49. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

50. Muli niyang tiningnan ang nakabulagtang si Ogor.

Recent Searches

nakakapagtakapulawellcebuspendinggodjackzlarry1973pinggankumaripaslindolikinabitdinaladividesdercrossipapahingaflyinterpretingplatformsobstaclescallactingauditsincesutilkurakotmapdeveloptipiginitgitconvertingayanipinalutofacebroadcastsbringingmonetizingblesssuchibapakelameroakalaspillnagbuwisgabi-gabinaiilangmagsusuottinawagpumasokikukumparapagkapasoknaibibigayt-isatissuemagitingnobelacynthianatinagwinepagkabuhaysinabinagpapaigibkasaganaanunibersidadpinagkaloobaninutusanmay-bahaypag-iwantuluyangkilalang-kilalasultantaongcalambablazingvaliosalikasdireksyonbilihinumiisodmasaholsalbahengspeechmandirigmangkanayangcommercialincrediblemasungitendvideretubigpakaininsementobunutanengkantadamawalavegaspinaggagagawanitosistemakawalactivitymag-asawaganuncashcalidadkatulongillegalkaraniwangbayangmalaki-lakimababatidsocialebumabalotpondosantosbuwayarolandmerchandisegjortmagbasabanyokasaldeterminasyonexpresanhoytagaroontugontag-ulanearnpsssaksidentemaidtiningnankarangalanmatigasmongpasigawmataposilawmalumbaykaarawandisyembremagkasing-edadanitobasahinmalambingvelstandhugisbansangbecamepinasoknapabalitatonetteskynagkikitakayabangancelularesgamitintaasiniinomtabingdagatbilaocomputere,pulubifionaokaysigemataotiketnevertrycyclebipolarsagabalgaanolargepalaydietbutihinggivedalawaresortamerikadumibecomebinigay1000cupidomgpopularizemakapag-uwihabilidadesalistingnandinadasalyunglangitnaiinggitsoonvasques