Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

66 sentences found for "through"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

3. Ailments can be managed through self-care practices, such as meditation or physical therapy.

4. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

5. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

6. And often through my curtains peep

7. Before television, most advertising was done through print media, such as newspapers and magazines

8. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

9. But all this was done through sound only.

10. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

11. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

12. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

13. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

14. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

15. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

16. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

17. Espresso is a concentrated form of coffee that is made by forcing hot water through finely ground coffee beans.

18. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

19. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

20. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

21. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

22. I know you're going through a tough time, but just hang in there - you're not alone.

23. I'm going through a lot of stress at work, but I'm just trying to hang in there.

24. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

25. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

26. Investors can purchase shares of stocks through a broker or online trading platform.

27. Limitations can be addressed through education, advocacy, and policy changes.

28. Limitations can be overcome through perseverance, determination, and resourcefulness.

29. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

30. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

31. Money can be earned through various means, such as working, investing, and entrepreneurship.

32. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

33. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

34. Patients are usually admitted to a hospital through the emergency department or a physician's referral.

35. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

36. People can also borrow money through loans, credit cards, and other forms of debt.

37. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

38. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

39. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

40. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

41. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

42. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

43. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

44. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

45. She spends hours scrolling through TikTok, watching funny videos and dance routines.

46. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

47. Some ailments are preventable through vaccinations, such as measles or polio.

48. The app has also become a platform for discovering new music, with songs going viral through TikTok.

49. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

50. The CEO received a hefty bonus for successfully leading the company through a period of growth.

51. The king's legacy may be celebrated through statues, monuments, or other memorials.

52. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

53. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

54. The President is elected every four years through a process known as the presidential election

55. The scientific method involves forming hypotheses and testing them through experiments.

56. The scientific method is used to test and refine theories through experimentation.

57. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

58. The title of king is often inherited through a royal family line.

59. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

60. This is a tough situation, but we'll get through it if we hang in there.

61. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

62. Viruses can spread from person to person through direct contact, airborne transmission, or contaminated surfaces.

63. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

64. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

65. Women have made significant strides in breaking through glass ceilings in various industries and professions.

66. You're stronger than this, pull yourself together and fight through the tough times.

Random Sentences

1. Les enseignants peuvent dispenser des cours de rattrapage pour les élèves qui ont des difficultés à suivre les cours.

2. Nakakatakot ang gagamba na kanyang nakita.

3. Mas pinapaboran ko ang pulotgata kaysa sa kendi kapag gusto ko ng matamis na panghimagas.

4. Menghabiskan waktu di alam dan menjalani gaya hidup yang sehat dapat meningkatkan perasaan kebahagiaan.

5. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

6. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

7. Ang talambuhay ni Juan Luna ay nagpapakita ng kanyang husay at kagalingan bilang isang pintor.

8. Nakita nilang ang balat ng bunga ay manipis at maliit ang buto.

9. Kung may tiyaga, may nilaga.

10. Ang biograpo ay nagsusulat ng mga kwento ng buhay ng mga kilalang personalidad.

11. At blive kvinde kræver også mod og selvstændighed.

12. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

13. Si Hidilyn Diaz ay ang unang Pilipinong nakapag-uwi ng gintong medalya mula sa Olympics.

14. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

15. Patuloy ang kanyang paghalakhak.

16. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

17. Papuntang Calamba ang dilaw na bus.

18. Sa kasal, ang pagdadala ng mga panulat ay mahalaga upang masigurong makapagsulat ng matatalinong mensahe sa guest book.

19. Salatin mo ang kahon kung may natira pang laman.

20. Naidlip siya at nang magising, nakita niya ang magandang dilag.

21. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

22. Kami ay umalis ng kaharian para ipagamot si Helena.

23. Have we completed the project on time?

24.

25. Kailangan mong lumabas sa iyong kahon upang makita mo ang kaibuturan ng mundo.

26. Manahimik ka na nga, tara ng umuwi! Andyan na driver ko!

27. Bis bald! - See you soon!

28. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

29. Kahit nasa gitna ng kainan, siya ay tulala at parang may iniisip.

30. Ang alon sa karagatan ay malakas ngayon dahil sa bagyong dumaan.

31. Ang saranggola ni Pedro ay mas mataas kaysa sa iba.

32. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

33. Mula sa malayo, anong gulat nila Magda nang makitang nagtalunan sa ilog sina Maria at Jose upang humabol.

34. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

35. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

36. I woke up to a text message with birthday wishes from my best friend.

37. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

38. Kelangan ba talaga naming sumali?

39. Ang tamang dami ng pagtulog ay nakakatulong sa pagpapalakas ng immune system.

40. Magdamagan silang nagtrabaho sa call center.

41. Napuyat na ako kakaantay sa yo.

42. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

43. Hindi dapat tayo gumamit ng marahas na wika sa mga pag-uusap.

44. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

45. Dinig ng langit ang hiling ni Waldo upang ang paghihirap nila ay mabigyan ng wakas.

46. Hindi siya nag-aral para sa pagsusulit, samakatuwid, bumagsak siya.

47. Hindi malinis ang tubig na iyan, bumili ka ng iba.

48. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

49. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

50. Ang paglapastangan sa dignidad ng kapwa ay hindi dapat maging bahagi ng ating kultura.

Similar Words

Throughout

Recent Searches

throught-shirtbinabaliktinulak-tulakmapaibabawnalulungkotmagtanghaliannagtrabahohuwebesisinulatdiretsahangcourtmasinopmedisinasequenapakagandaadgangpromotingtheirlabinsiyamkomedorkaklasepagkabiglamagsasakabilerkisssyaawtoritadongregularmentepambatangnakainomricatumunogngumiwiipinatawagsumpaintsismosaburgerdepartmentmakilalaintindihinkolehiyohalosnapasubsobskyldes,alaganganumangtagpiangdiferenteskinuhasisikatlumusobjosiebakantehahahamaghihintaycountrymagkanoriegaspeechesisinamalandasaayusinunconstitutionallandetmagagandangsabongunangpumikitumokaysaktansteamshipssurveyskargahannagbibigayanbintanasakopipapaputolgawaandreananigasspreadteachingslumahokmaestractricasmanalopinalambotnakapikitbinabarattirangkundimanfollowednagniningningisinarapinagmamasdane-commerce,katulongsayaalagacompletamentetilirobinhoodpokerabutansakaymarinigkainannababalotkatagangmatangumpaymatangkadhitmakaiponinalagaankantusindvispagdiriwangdesarrollarhoteltsupersalbahekargangpagkattawareynatasasirawhichtengalayuanmataaashumpaysagaptambayanmagigitingtelefonincidencecnicokatapatinakyatisamakalongmabaitpresleyasiatickulangteachernenastruggledpalangsumuotkumukulostuffedairconpopularsumasakitpongdibapagpapasakitnahihiloinihandamanghulidissemataraynahigasundaeelectronicassociationadoptedblusamanuksobuenahinognicobutchstonagtutulakkinsefilmsnapatinginyatamegetselltoothbrushwritinghangaringfurlossbitiwanlapitanadicionalescapitaltransmitsblusangonlineattractivemangingisdamagsusunuranpage