Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "invention"

1. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

2. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

3. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

4. The invention of the telephone and the internet has revolutionized the way people communicate with each other

5. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

6. The invention of the telephone led to the creation of the first radio dramas and comedies

7. The telephone has undergone many changes and improvements since its invention

8. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

9. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. Tinuruan ng albularyo ang kanyang anak upang maipasa ang tradisyon ng pagpapagaling gamit ang mga halamang gamot.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3. He was busy with work and therefore couldn't join us for dinner.

4. Bitawan mo nga ako, kakainin ko 'to.

5. Hang in there and stay focused - we're almost done.

6. Pagkain ko katapat ng pera mo.

7. I am absolutely determined to achieve my goals.

8. Les étudiants sont encouragés à poursuivre des activités de bénévolat pour développer leurs compétences en leadership.

9. She has just left the office.

10. Ang pagdadasal ng rosaryo tuwing alas-sais ng gabi ay isang ritwal na hindi nila kinalilimutan.

11. Tumango ako, you want? alok ko sa kanya.

12. Hindi pa rin siya umaalis sa kinauupuang balde.

13. El arte abstracto se centra en las formas, líneas y colores en lugar de representar objetos reales.

14. Sa wakas, aalis na si Ogor, naisip niya.

15. Puwedeng dalhin ng kaibigan ko ang radyo.

16. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

17. Tila hindi niya gusto ang mga sinabi mo.

18. Hindi umano totoo ang mga balitang nag-resign na ang presidente ng kumpanya.

19. The officer issued a traffic ticket for speeding.

20. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

21. Las serpientes tienen una mandíbula flexible que les permite tragar presas enteras, incluso si son más grandes que su propia cabeza.

22. Ewan ko apelyido pero basta Memo, kilala ka kasi nya eh.

23. Narinig ni Ana ang boses ni Noel.

24. Ipaliwanag ang mga sumusunod na salita.

25. A lot of snow fell overnight, making the roads slippery.

26. Nagsmile siya sa akin, Bilib ka na ba sa akin?

27. Ang takip-silim ay isang magandang panahon para sa mga nagmamahalan at naglalakad sa ilalim ng mga ilaw ng poste.

28. Sa mula't mula pa'y itinuring na siya nitong kaaway.

29. Kapag umuulan, hindi puwedeng maglaba ng mga damit sa labas.

30. Durante las vacaciones de otoño, visitamos viñedos para la vendimia.

31. Jeg har lært meget af min erfaring med at arbejde i forskellige kulturer.

32. Nagsine kami kamakalawa ng hapon.

33. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

34. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

35.

36. Ang bagal mo naman kumilos.

37. Ramdam na ang pagod at hingal sa kaniyang pagsasalita.

38. Pumupunta siya sa Maynila bawat buwan.

39. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

40. Isang Saglit lang po.

41. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

42. Ang paglapastangan sa mga bata at kababaihan ay isang malaking suliranin sa lipunan.

43. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

44. Sino-sino ang mga kakuwentuhan mo sa klase?

45. Payat na payat na ang ama't ina niya para matustusan ang kanyang pangangailangan.

46. Las hojas de los árboles proporcionan sombra y protección contra el sol.

47. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

48. Bakso adalah bola daging yang disajikan dengan mie dan kuah kaldu.

49. Kinakailangan niyang kumilos, umisip ng paraan.

50. Hello. Magandang umaga naman.

Recent Searches

lupaingowncampaignsinventionumagawkamakailanmatamantugono-ordermayamangkuwebanakinigaddictionkaysalaranganelenatigaspakaininnoongardenparurusahanbuntisginawacnicokontingtuvokriskateacherlipadlingidnagkaganitonammagkasinggandalaybrarieclipxehmmmbingbingassociationitutolmatulisfarmthankkananitongamerikagamitincellphonedeteriorateubodomeletteindiadyipkasingtigasadangmasdanbatayritoallotteddawmabilisisugaearncompostelaroomginangfestivaltomardraybermatangroboticlasingerosumusunomatchingbienabitingbokmayabangakingawaeducationalpaslitbigbarbeintetransitbusmaaringproducirsatisfactiontahimiktooprotestahapasingotpersistent,crosshimdoscorrectingsafepdaeksamnagplaynalulungkotna-curiouskulotpumulothateevolvedandroidmakapilingiginitgitrequirepilinglasingeditorwaitmessagebasaalimentopagkaangatpaki-basanakakulongmbaloamonggalakwakasgitnavaledictorianmaaksidentelegislationkoronalangnag-aalaynapalingonninasumakaymadalaspagpapakilalanagkitamakapangyarihangnakakadalawgumagalaw-galawmagpa-picturenagtutulungankinakitaanpagpapakalatdadalawintinangkamagsusunuranmamanhikanpanghabambuhaybinibiyayaanmagbabagsikpinagalitannalalamansalamangkeropulisukol-kaybabasahingumagamitkasiyahanmakatarungangpupuntahanrebolusyonnapasigawihahatidnalugmokselebrasyonpaglalabamagsasakaengkantadangnaiilangjuegosnakapasapansamantalakalakitumirasinaliksiknakakatabaevolucionadosiguradosuzetteperpektingpaghuhugasopisinalumutangmahirapibabawmagtigilpaghaliksandalinabigyansinopatawariniligtaspakistannapapadaancanteen