Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "invention"

1. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

2. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

3. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

4. The invention of the telephone and the internet has revolutionized the way people communicate with each other

5. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

6. The invention of the telephone led to the creation of the first radio dramas and comedies

7. The telephone has undergone many changes and improvements since its invention

8. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

9. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. May mga punong-kahoy na pinaniniwalaang matatanda nang bago pa dumating ang mga kolonizador.

2. All these years, I have been building a life that I am proud of.

3. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

4. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

5. Estoy muy agradecido por tu amistad.

6. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

7. Ang debate ay ukol sa mga isyu ng korapsyon sa gobyerno.

8. El curry tiene un sabor picante y aromático que me encanta.

9. Lumuhod siya sa harap ng altar at tulala sa loob ng ilang minuto.

10. Nagkaroon sila ng maraming anak.

11. They are hiking in the mountains.

12. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

13. Nakipag bahay-bahayan kay Athena.

14. Emphasis can also be used to create a sense of urgency or importance.

15. Nahihilo ako dahil masyadong mainit ngayon.

16. La tos puede ser un síntoma de COVID-19.

17. Limitations can be a result of geographic location or access to resources and opportunities.

18. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

19. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

20. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

21. Ese vestido rojo te está llamando la atención.

22. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

23. Mas magaling siya kaysa sa kanya.

24. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

25. Mahalagang magtiwala sa ating kakayahan upang maabot natin ang ating mga pangarap, samakatuwid.

26. Ang Chinese New Year ay isa sa pinakamahalagang pagdiriwang sa kultura ng Tsina.

27. Bumilis bigla yung tibok ng puso ko.

28. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

29. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

30. Naghahanap ako ng mapa ng bansa para sa aking proyektong pang-geography.

31. Alas tres ang alis ng tren tuwing hapon.

32. A lot of time and effort went into planning the party.

33. Ako si Rodona ang diwata ng budok na ito.

34. The dog barks at the mailman.

35. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

36. Tumagal ng ilang araw bago mawala ang pamamaga ng kanyang paa.

37. Ang paggamit ng droga ay hindi lamang nakakasira ng kalusugan ng isang tao, kundi maaari rin itong magdulot ng epekto sa buong lipunan.

38. Nagpamasahe ako sa Boracay Spa.

39. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kita ligawan?

40. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

41. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

42. "Kung walang tiyaga, walang nilaga" ay isang bukambibig na nagpapahayag ng katotohanan na ang kakulangan ng pasensya at pagsisikap ay magdudulot ng kawalan ng tagumpay.

43. Iskedyul ni Tess, isang estudyante

44. Dalawampu't walong taong gulang si Paula.

45. Malaki ang kama sa kuwarto ni Olivia.

46. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

47. Dali-daling umalis ang binata patungo sa palasyo.

48. Gusto po ba ninyong lumipat sa ibang kuwarto?

49. Ang pagsisimula ng malakas na away sa loob ng tahanan ay binulabog ang katahimikan ng pamilya.

50. Umingit ang sahig ng kanilang barungbarong nang siya'y pumasok.

Recent Searches

magdaanhinintayinventionlittlee-commerce,arabiadakilangmasukolsementosalesmachineshinabolofrecenbesestamadparoroonaisinumpasinungalingtondokinantahumbleelectoralkumukuloalamidsumisilipsapotlistahanmagigitingpagputibugtongpitakawowanimodatisabihingpeepoverallandamingwalngsasagotdreambukodbranchnapatingalaharappulubitwo-partytransmitidasmedidatiketcommunicationcolourmalimitjeromeworryumiilingfatdesdeformaspistaledcandidatedancecouldidea:conectancontinueswealthaddresstakemanageryeahprogressnapilingsariwamalakingmuchcornerprovidedcreationbringingkailankahaponkaano-anopalipat-lipatchoirparangligaligmagkasabaymaglalakadpinag-usapanlandlinemalihispinagsikapanbacktilaperfecthuniydelsernageenglishtalagaaraygulatnagsisigawinilagayagam-agamkirotkasingpageoverkumapitkulogambisyosangmatiwasay18thpyestapasangipagamotmatangvotesipinikitmasyadongbilismalezapunongkahoymagbabakasyonpamburapinakamagalingnakagalawmarvinvirksomheder,malamigguidancepagpapautangalikabukinnamulatnamulaklaktatawagpinagalitanmagbabagsiknagpakunotnabubuhaykuwartoerlindamaglalaroinvestingmagdilimwatawatkamakailantatayomaipagmamalakingkakataposairportipinatawagnaglaonberegningerisinagotbutikitaga-ochandotinungotennispakistanoperativosbangkangmarangalfulfillmentattorneyperyahanundeniabletagalhinilakalaronamilipitnataloininomenglandasahanpatongkatulongtiyanasianapilitangskyldespa-dayagonalganitotagaroonwifikombinationstreetthanklaybraricoalkinainsagapparurusahanmagbigayannagbasaokayfameutiliza