Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "invention"

1. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

2. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

3. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

4. The invention of the telephone and the internet has revolutionized the way people communicate with each other

5. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

6. The invention of the telephone led to the creation of the first radio dramas and comedies

7. The telephone has undergone many changes and improvements since its invention

8. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

9. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. Ano ang ikinamatay ng asawa niya?

2. Ilan ang telepono sa bahay ninyo?

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. Matayog ang pangarap ni Juan.

5. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

6. Ang tahanan ng mga ibon sa tabi ng ilog ay mayabong at nagbibigay ng malasakit sa kalikasan.

7. Nakakatakot maglakad mag-isa sa hatinggabi sa isang hindi kilalang lugar.

8. Living with uncertainty can be challenging, but it can also lead to greater resilience.

9. Higupin ng halaman ang tubig mula sa lupa.

10. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

11. Ang kaniyang ngiti ay animo'y nagbibigay-liwanag sa madilim na kwarto.

12. Napakabagal ng internet sa aming lugar.

13. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

14. Motion er en vigtig del af en sund livsstil og kan have en række positive sundhedsmæssige fordele.

15. May notebook ba sa ibabaw ng baul?

16. Sa takot ay napabalikwas ang prinsesa at tinungo ang isang malapit na hukay.

17. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

18. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

19. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

20. Lumbay na naman si Jose matapos matalo sa sabong.

21. Hindi ako mahilig kumain ng pulotgata dahil sa sobrang tamis nito.

22. Tila siya ang paboritong estudyante ng guro.

23. Ano ang isinulat ninyo sa card?

24. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

25. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

26. I am not listening to music right now.

27. Napansin niya ang mababa ang kita ng tindahan nitong buwan.

28. Ang Ibong Adarna ay nagpapakita ng kapangyarihan ng kabutihan at pag-ibig sa pagharap sa masasamang tao.

29. Ada juga tradisi memberikan kue atau makanan khas sebagai bagian dari perayaan kelahiran.

30. may butil na rin ng pawis sa kanyang ilong.

31. The scientific community is constantly seeking to expand our understanding of the universe.

32. Paano po pumunta sa Greenhills branch?

33. Ang kanyang ama ay isang magaling na albularyo.

34. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

35. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

36. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

37. Kinuha naman nya yung isang bote dun sa lamesa kaso.

38. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya, at ito ay nagdulot ng interesante at makabuluhan na pag-aaral.

39. Kapag nasa agaw-buhay na sitwasyon, kailangan nating mag-ingat at magtulungan para sa ating kaligtasan.

40. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

41. Ibig sabihin, nagpepeke pekean ka lang ng luha kanina?!

42. May tatlong bituin ang watawat ng Pilipinas.

43. Goodevening sir, may I take your order now?

44. Sayang, apakah kamu bisa mengambil anak-anak dari sekolah nanti? (Darling, can you pick up the kids from school later?)

45. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

46. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

47. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

48. The baby is not crying at the moment.

49. Ano ang gusto mong gawin kapag walang pasok?

50. Meal planning and preparation in advance can help maintain a healthy diet.

Recent Searches

naglalarohimselfprinceinventionvedpamasaheeffortskargahankalonglalakecocktailpaglapastanganpagkabuhaymakikipaglaropakikipagtagpokaraniwangolivanagpalalimagilabansasinalansanflymuliitinaoblutocomuneskutodtravelkartonbinigyangbuntisparagraphsanimoykamustaadicionalesabrilisinalangreallykare-karealignsclasesmuchosminamasdanmatulisalintillstoplightadverseadvancedlibronaggingnagkakakaingenerabalearningbeyondsyncprovelumuwasincrediblemakabaliksasakaypositibotagalogtargetraworasmadadalapinigilansimuleringeridamagisipvalleynilaiskedyulanihinipinabalikmamanhikankuyanaglalakadbilangisiptalentnakakadalawpaglalabaomfattendemalasutlakalabanumanoalakeyeguestsvisnogensindegumapangnakangangangnaiisipkisapmatanataposmangkukulamkapangyarihangakmangnatigilannagnakawngipinfacultykahuluganvisualpilingbulaklakviewskilogumantinakikitangbieni-markmasasabicommunicationlivescoalpundidosikatradiocommissionmontreallarongkutonagyayangnakahainlagaslastuluyanyunginfluenceschooseumiinitmakakakaentwinkleprogramakakayanangfe-facebookwashingtonkapit-bahaysentencemahigitnakatindigeconomybingoseniortanggalinumagabentangdumagundongmangahasmadulasvigtigsteniyafacebookgapangelatitanakangisinahawakannakalipasbalangnakapangasawananlilisiknaiiritangbaranggaykinakitaangeologi,investcourttrabahokarapatangbasketballmangyarihospitalpakanta-kantangadvertising,maskinerconsistnahulaanmagkasabaypaghalakhakbateryayorkpinagkiskisscientificsorrybakanteguerreronuevonangagsipagkantahandenresearch,lumiitpanindangnatabunannakakapasokpangyayariestudio