Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "opportunity"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

3. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

Random Sentences

1. Anung email address mo?

2. El accidente produjo un gran tráfico en la carretera principal.

3. They do not ignore their responsibilities.

4. Ang paghahanap ng katarungan at pagkamit ng hustisya ay nagpapawi ng galit at pagkadismaya.

5. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

6. Hindi mapigil ang pagkakatitig niya sa pagkain na naglalaway na sa harap niya.

7. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

8. The lightweight design of the tent made it easy to set up and take down during camping trips.

9. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

10. Mi amigo de la infancia vive ahora en otro país y lo extraño mucho.

11. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

12. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

13. Sa pagsasagawa ng outreach program, ang bayanihan ng mga organisasyon ay nagdulot ng pag-asa at pag-asa sa mga benepisyaryo.

14. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

15. At habang umiisod ang pila, nararamdaman niyang lalong umiinit ang sikat ng araw.

16. La paciencia nos enseña a esperar el momento adecuado.

17. Kung hei fat choi!

18. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

19. Ang mga marahas na laban sa karapatang pantao ay dapat labanan at iwaksi.

20. Ang bawat tao ay may natatanging abilidad na nagbibigay kahulugan sa kanilang buhay.

21. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

22. She's always gossiping, so take what she says with a grain of salt.

23. Has she met the new manager?

24. Puwede ba kitang ibili ng inumin?

25. Les travailleurs doivent respecter les heures de travail et les échéances.

26. Television is a medium that has become a staple in most households around the world

27. Scissors have handles that provide grip and control while cutting.

28. Nagpamasahe ako sa Boracay Spa.

29. En la realidad, las cosas no son siempre en blanco y negro.

30. El deportista produjo un gran esfuerzo para ganar la competencia.

31. Bukas ay magpapagupit na ako ng buhok.

32. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

33. Dumaan ako sa silid-aralan upang magpasa ng papel sa guro.

34. Forgiveness is a gift we give ourselves, as it allows us to break free from the chains of resentment and anger.

35. The culprit behind the product recall was found to be a manufacturing defect.

36. Naghihinagpis si Maria nang malaman niyang hindi na niya makakasama ang kanyang pinakamamahal na aso.

37. Beauty? tanong pa ni Mrs. Lacsamana.

38. Está claro que la evidencia respalda esta afirmación.

39. Work-life balance is important for maintaining overall health and wellbeing.

40. Endelig er Danmark også kendt for sin høje grad af økologisk bæredygtighed

41. Ang daming kuto ng batang yon.

42. Ang pag-aaral ng tao ay hindi lamang sa labas kundi pati sa kaibuturan ng kanyang pagkatao.

43. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

44. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

45. Gusto kong bumili ng bestida.

46. Gracias por ser una inspiración para mí.

47. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

48. En mi huerto, tengo diversos cultivos de flores y plantas ornamentales.

49. Omelettes are a popular choice for those following a low-carb or high-protein diet.

50. The artist painted a series of landscapes inspired by her travels.

Recent Searches

opportunitycompletehabangnagdalainuulamisinakripisyotanawhunioutkalakihannagtagisanpagkabiglanapaluhanakaluhodkasingtigasemocionesbehaviornamnaminpaumanhinplatformawardna-suwaysinasabipersonalbinitiwannagwikangkaarawannatupadanoginangroquenagsamapatutunguhanbutihingsumalabumibitiwpinuntahanmalezabotantelalapagbibirooperahanbangkopaskongedsalandmangehetopumatolnagkantahangiverunconstitutionalmaingatalaymagpapigilsitawbukodmagbubungamagaling-galingtravelkaloobangviewspatienceimbes1940sandalingumokaysenateisipsalanumerosassinagotfionatakescitizennilulonredigeringsnakabosesmaghahandanakapuntasinampalitocelulareseskuwelaofficeniyonsumarapfuefournalangbienmisyunerongwowfertilizerbokpinakamasayafeelwalangartsgraduallyabalabagosukathearverypopularizereserveseksaytedtumutubonagawanakatindigmaanghangcelebramananaogpalapitmightnalalaglaglagunapshrabestatusendvidereechaveimpitnangahaskutsilyomaibiganscientificelvisumalissimulanewspapersbibigyantalagatrafficlumipadmaliliitanumankapalbook:palipat-lipatperseverance,beintesusunodmapakalinagplaygoshpagtataposstot-isadahilanlegislativekumarimotmaduraselectionfriesuniversitiesitakmurangmaramitenbiggestchad10thmagbigaybirobabaesolidifybilismagsusuotnagsisigawtanganmarieganunpagluluksabingokunwapasensyanagliliwanagcomplexdescargarnagre-reviewconditionyumabangtuparinpinalambotfindsutilillegalgawaumiinitjackypinatidspeechesreguleringnagdaramdaminiibigcontinuesdid