Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "led"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

3. Cancer research and innovation have led to advances in treatment and early detection.

4. Einstein's work led to the development of technologies such as nuclear power and GPS.

5. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

6. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

7. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

10. Scientific research has led to the development of life-saving medical treatments and technologies.

11. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

12. The DNA evidence led to the arrest of the culprit in the murder case.

13. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

14. The invention of the telephone led to the creation of the first radio dramas and comedies

15. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

16. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

17. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

18. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

19. The uncertainty of the job market has led to many people rethinking their career paths.

20. The uncertainty of the weather has led to the cancellation of the outdoor event.

21. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

22. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

23. This has led to a rise in remote work and a shift towards a more flexible, digital economy

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Ano ang sasabihin mo sa kanya?

2. Ang aming kasal ay nagpapakita ng pagkakaisa at pagmamahal sa pagitan naming dalawa bilang magkabilang kabiyak.

3. Walang puno ang hindi hitik sa bunga.

4. Kailan ba ang flight mo?

5. Ang mga pamilya ay nag-aayos ng mga handa at nagdadasal para sa kasaganaan sa darating na taon.

6. Alam kong heartbeat yun, tingin mo sakin tangeks?

7. Bumuga siya ng hangin saka tumingin saken.

8. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

9. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

10. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

11. Omelettes are a popular choice for those following a low-carb or high-protein diet.

12. Ngayon ka lang makakakaen dito?

13. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

14. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

15. Las escuelas son lugares de aprendizaje para estudiantes de todas las edades.

16. En invierno, las personas disfrutan de bebidas calientes como el chocolate caliente y el té.

17. Sa kanilang panaghoy, ipinakita nila ang tapang sa kabila ng matinding pagsubok.

18. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

19. She surprised me with a cake on my last day of work to bid me farewell.

20. Nasa akin pa rin ang huling halakhak.

21. The tree provides shade on a hot day.

22. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

23. Ha? Anong konek ng gas sa taong nagugutom?

24. Kanina ka pa? tanong ni Aya sa akin.

25. Påskelørdag er dagen, hvor Jesus lå i graven, og der afholdes ofte en stille og reflekterende gudstjeneste.

26. The executive branch, represented by the President of the United States, is responsible for enforcing laws

27. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

28. Natutuhan ng mga mag-aaral ang talambuhay ni Lapu-Lapu bilang isang bayaning lumaban sa dayuhang mananakop.

29. El invierno es una de las cuatro estaciones del año.

30. Walang sinuman ang nangahas na kontrahin ang plano ng kanilang lider.

31. Maaga dumating ang flight namin.

32. Katamtaman ang pangangatawan ng nanay ko.

33. Don't count your chickens before they hatch

34. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

35. Rektanggulo ang hugis ng mesa namin.

36. They have been friends since childhood.

37. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

38. Está claro que la situación ha cambiado drásticamente.

39. El cordón umbilical, que conecta al bebé con la placenta, será cortado después del nacimiento.

40. Sa mga gubat ng Mindanao, may mga punong-kahoy na may napakalaking kahoy at tinatawag itong "Lauan".

41. Wala na akong natitirang pera, umaasa na lang ako sa ayuda.

42. Pag-ibig na palaisipan, sa kanta na lang idaraan

43. Ang linaw ng tubig sa dagat.

44. My coworkers threw me a surprise party and sang "happy birthday" to me.

45. Saan pumupunta ang manananggal?

46. Pumasok sa sinehan ang mga manonood nang limahan.

47. Hindi na niya kaya ang mabibigat na gawain dahil mababa ang kanyang lakas.

48. Nang buksan ng mga tao ang ilang bunga ng punong-kahoy, kanilang nakitang ang balat ay makapal at ang buto ay malaki, ngunit ang laman nama'y matamis

49. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

50. Yan ang panalangin ko.

Similar Words

dialledvaledictorianControlledbalediktoryanknowledgerolledso-calledstruggled

Recent Searches

ledbroadlayuninchefartificialhoweverstuffedalinelectronicrolledpigingmalikotmaibalikinimbitahikinginiibigiskedyulkulotcarloinalagaanplagastibigcarriescoalgumuhitcashnasuklamcovidnangangahoypagkakayakapnagulatsalamangkeropresidentialtinulak-tulaknaglalakadkinamumuhianpinag-usapannapaplastikanpakikipagtagponapakamisteryosowalkie-talkiemagpa-ospitalnangagsipagkantahanmaipantawid-gutomdondenagkasakitnecesariopangungusapnakikitanghandaanumiinombeautyleksiyonmagtiwalamahuhusaylivenagdiretsoh-hoyrailwaysmgauusapannabubuhaynagpepekenakuhangmakahiramdisenyongkaloobangkinauupuangnakakapasokmusiciandropshipping,lumalakisasakaycompanymaynilaatmagsunogmusicalesrektangguloamericakumirotumagawthanksgivingkuryentemauliniganaaisshejecutanwakaspagkattatagalhawakhimayinkaysanabigyansurroundingspapuntangilagaymitigatelasasinehanpulitikokesotomorrowdiaperminamasdanhahahapaulit-ulitmaghaponnagbentanamuhaygospelnagsinena-curiouspinabulaanbihirangsangasagotsandalingngipingumigibbantulotbibilibumagsaksikatnahantadpulisradiodemocracylagifonossangfionabigyanconsumeindustryhugissonidosarilingpupuntafindshapingauditpangulodragonaalisakosusunduinlegislativeespadasaringpinag-aralanuuwiboksingpostcardmayotodopitakabatiadverseterminoisaacsellsantomodernpiecesgayunpamankinuskosnegativeetoauthorhalikaeducationalbadfacilitatingkarnabalputipdamapadalialejoydistansyanextperomukahcallingideamaputisquatterbadingparatingresourcesdigitalarmednothingnagginghimselfrelativelyimprovemagkasinggandarawdumating