Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "led"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

3. Cancer research and innovation have led to advances in treatment and early detection.

4. Einstein's work led to the development of technologies such as nuclear power and GPS.

5. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

6. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

7. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

10. Scientific research has led to the development of life-saving medical treatments and technologies.

11. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

12. The DNA evidence led to the arrest of the culprit in the murder case.

13. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

14. The invention of the telephone led to the creation of the first radio dramas and comedies

15. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

16. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

17. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

18. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

19. The uncertainty of the job market has led to many people rethinking their career paths.

20. The uncertainty of the weather has led to the cancellation of the outdoor event.

21. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

22. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

23. This has led to a rise in remote work and a shift towards a more flexible, digital economy

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Iilan pang taon ang nakalilipas sa kanyang pagka-Datu nang siya ay nagkaroon sa kanyang kabiyak ng isang tagapagmana ng kaharian.

2. Ang mga himig ng kundiman ay nagpapalaganap ng mga kuwento ng pag-ibig na hindi matutumbasan ng anumang kayamanan.

3. La pobreza es un problema que afecta a millones de personas en todo el mundo.

4. An omelette is a dish made from beaten eggs cooked in a pan.

5. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

6. All is fair in love and war.

7. He is watching a movie at home.

8. Nationalism is often associated with symbols such as flags, anthems, and monuments.

9. Les comportements à risque tels que la consommation

10. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

11. Hospitalization can be a time for patients to focus on their health and receive specialized care.

12. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

13. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

14. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

15. Tumingin siya sa wrist watch niya saka nag-isip.

16. Tila may bumisita sa bahay kagabi dahil may bakas ng paa sa labas.

17. Sandali na lang.

18. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

19. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

20. Las serpientes son reptiles que se caracterizan por su cuerpo largo y sin extremidades.

21. May klase ako sa Tagalog tuwing Lunes.

22. Pasensiya na kayo, Ale, sabi ng bata.

23. The pretty lady at the store helped me find the product I was looking for.

24. Comer una dieta equilibrada puede aumentar los niveles de energía y mejorar el estado de ánimo.

25. She has been tutoring students for years.

26. Mula sa malayo, anong gulat nila Magda nang makitang nagtalunan sa ilog sina Maria at Jose upang humabol.

27. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

28. Hinampas niya ng hinampas ng kidkiran ang binatilyong apo.

29. Para sa akin ang pantalong ito.

30. Bumuga na lang ng hangin si Maico saka tumingin kay Mica.

31. Suot mo yan para sa party mamaya.

32. Naglalaba siya ng mga kumot at kurtina upang mapanatili ang kalinisan ng aming tahanan.

33. Ito ay pinangalanang Hari ng Karagatan na walang takot kaninuman.

34. Ang pagkakaroon ng malubhang sakuna ay binulabog ang buong bansa.

35. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

36. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

37. Gusto ko hong gumawa ng reserbasyon.

38. Mabait na mabait ang nanay niya.

39. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. Nasa park sila at pinagmamasdan niya ang mga bata na naglalaro sa paligid.

42. La paciencia es una virtud.

43. Inalok ni Maria ng turon si Clara.

44. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

45. Lontong sayur adalah hidangan nasi lontong dengan sayuran dan bumbu yang khas Indonesia.

46. La labradora de mi cuñado es muy ágil y puede saltar obstáculos muy altos.

47. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

48. Sa anong materyales gawa ang bag?

49. May gusto ka bang gawin mamayang gabi?

50. El nacimiento es un evento muy emocionante y significativo en la vida de una familia.

Similar Words

dialledvaledictorianControlledbalediktoryanknowledgerolledso-calledstruggled

Recent Searches

ledmaaringmakakatakasculpritkumidlatpayonglalargasinakopinaapimulti-billionpagdudugoprogresssequeconnectingmarielfuncionarobservererpangangatawanpangalanlasingsulinganbugtongconectanskypenapapadaantinginmarahilbeachgandapinagtagpoikinakatwiranorastododamitnasasakupannagtungocirclenag-aarallarawanmaghaponbaoseryosongbumaliknamaarmedconvertingcarssikre,kagandahagpamburaelectionsgloriagamesthroatnapatawagbutiusapinapalomagbibiyahesocialekanikanilangpinatiramaidmaynilawishingcampaignstinangkabangkofederalismlungsodsinapalengkeinspirasyonumiimiknahintakutanerlindaflyvemaskinernagbibiroparabulaklakmawalaanilakailanganfavoreksportenpagsumamonangingisaylaterdreambayaningespecializadaslimatiknatuwanamibinubulongeventospagkalitogandahankinasisindakanroquematamanimagesdanceskyldes,globalisasyonmasasalubongdesign,factoresemocionesmakikiraannewshinukaymerchandisemisteryonuclearngipinghininginagsisipag-uwianumiilingskyldesexecutivemarianshineskapalrightsexampagkahapolalabasstorebinilicommunicationshinahaplosmatigasbubongmagkaharappootpersistent,samakatwidmarmaingdisfrutarentrymataraypinilingatagilirancualquierwouldsarongpatulogdefinitivoalaalainuminitutoltawananmagdaraosnaliwanaganmagalitbalinglayuninamingbigongguiltyumokaymagdarosanatulogtandalookedmagpapigilnaghihirapmethodsnagdaosiginitgitlabananamendmentslumabaspagkalungkotwebsitedesarrollarnalasingrevolutionizedrollilingpanginoonpamamahingapointamparonaliligolumisanangalpapansinintumabanowsuhestiyonantonionakukulilikomedorkailannakagawianpampagandacrush