Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "led"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

3. Cancer research and innovation have led to advances in treatment and early detection.

4. Einstein's work led to the development of technologies such as nuclear power and GPS.

5. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

6. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

7. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

10. Scientific research has led to the development of life-saving medical treatments and technologies.

11. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

12. The DNA evidence led to the arrest of the culprit in the murder case.

13. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

14. The invention of the telephone led to the creation of the first radio dramas and comedies

15. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

16. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

17. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

18. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

19. The uncertainty of the job market has led to many people rethinking their career paths.

20. The uncertainty of the weather has led to the cancellation of the outdoor event.

21. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

22. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

23. This has led to a rise in remote work and a shift towards a more flexible, digital economy

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Naku, wala ka naming gagawin sa Davao.

2. Anong ginagawa mo? nagtatakang tanong ko.

3. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

4. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

5. Magdamagan silang nagtrabaho sa call center.

6. He is not watching a movie tonight.

7. Tumagal ng tatlong oras ang kanyang operasyon.

8. Matagal-tagal na siyang tulala, hindi niya alam kung ano ang gagawin.

9. Naghingi ako ng pahintulot na hiramin ang mga kasangkapan sa kusina para sa aking cooking class.

10. At være ærlig over for os selv og andre er vigtigt for en sund samvittighed.

11. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

12. Parehas na ayaw magbigayan ang dalawang pangkat at pinipilit na sila ang mas nararapat kaysa sa isa.

13. The Lakers continue to be a dominant force in the NBA, with a dedicated fan base and a commitment to excellence on and off the court.

14. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

15. Some fruits, such as strawberries and pineapples, are naturally sweet.

16. Mayroon pa ho sana akong gustong itanong.

17. Haha! I'd want to see you fall inlove tonight.

18. They ride their bikes in the park.

19. Ang ganda naman ng bago mong phone.

20. Where there's smoke, there's fire.

21. Maligo kana para maka-alis na tayo.

22. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

23. Gusto kong malaman mo na may ganitong pakiramdam ako, kaya sana pwede ba kita ligawan?

24. Trapik kaya naglakad na lang kami.

25. Honesty is the best policy.

26. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

27. Maarte siya sa kanyang hitsura kaya lagi siyang nakabihis ng maganda.

28. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

29. Kahit ang diyosang si Venus ay walang panama sa kaniya.

30. She has been knitting a sweater for her son.

31. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

32. Pedro at Juan ang mga pangalan ninyo.

33. Higupin natin ang gatas habang mainit pa.

34. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

35. Jacky! magkasabay na sabi nung dalawa.

36. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

37. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

38. Kinapanayam siya ng reporter.

39. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

40. Hindi na napigilan ni Anna ang kanyang hinagpis nang marinig ang masamang balita.

41. Napadungaw siya sa bintana upang tingnan ang magandang tanawin.

42. Kailangan mong lumabas sa iyong kahon upang makita mo ang kaibuturan ng mundo.

43. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

44. Facebook offers targeted advertising options for businesses and organizations to reach specific audiences.

45. Scissors should be kept sharp to ensure clean and precise cuts.

46. Ibinigay ko sa kanya ang pagkakataon na magpakilala sa kanyang mga kaisa-isa.

47. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

48. Los bebés pueden necesitar cuidados especiales después del nacimiento, como atención médica intensiva o apoyo para mantener la temperatura corporal.

49. Actions speak louder than words.

50. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

Similar Words

dialledvaledictorianControlledbalediktoryanknowledgerolledso-calledstruggled

Recent Searches

generatetomledinformationrestpracticadorepresentednotebookconsideralignspointapollohimselfmagbubungaprotestagraduallyhateclassesatingshouldfrogremembertypeswhethersabadongpaglalabadadumagundongnagsuotsiniyasatngumingisimaghahabiespanyolpeksmannasagutannakabluetelecomunicacionesgagamitpagsidlanunosexpeditedanitoaaisshtinanggaptumangokoreareservesfiakerbbobouncheckedsinabiakohuhpresenceschedulenotstringkarapatangmurang-murapamilyangsay,kagipitanmabihisanprincipalesharapanginawaranjeepneyinintaymisyunerongsino-sinobilldatipinagsikapannatagalanpusapinyahalamananprofessionaljackyfuncionaramazonnakakitabyggetapelyidopakibigyanpanginoonquarantinetagalnahulaanbisikletapinatirarailwayslutomatchingnalugodyonthirdnapaplastikanmatitigasnabiglakatagangampliatinapayumaagoskunerollednobleboyetwalletkararatingsambitsyncnagtitindamagkaibanginirapanutak-biyapumitasnag-emailmarasigantagtuyotsuriinniyosayawanwondermatayogmaisipgoingbilipalakadiagnosticgisinglumamangnamingmajorwaitdecisionsplatoinspirasyonibinubulongmagkasakitglobalisasyoncandidatescultivationamoyestosnagtutulunganskyldespagsusulittibokosakapakainsakinipipilitxixcrazyrelativelyprovidedenternameagebaduyelectionlumiwagpinapatapospakipuntahanletterpagkuwamenosgrupokumiloshigupinpunongkahoybirthdaymagbabakasyonmakauuwinanahimiknagpaiyaknagmakaawafreelancersinasabiunannaka-smirksincepulongculturetahimikmaghihintayusuarioinaasahanfulfillmentnaglaonmakinangcoatcalambananigaspanatagkaniyagovernmentrepublicanthank