Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "led"

1. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

2. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

3. Cancer research and innovation have led to advances in treatment and early detection.

4. Einstein's work led to the development of technologies such as nuclear power and GPS.

5. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

6. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

7. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

10. Scientific research has led to the development of life-saving medical treatments and technologies.

11. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

12. The DNA evidence led to the arrest of the culprit in the murder case.

13. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

14. The invention of the telephone led to the creation of the first radio dramas and comedies

15. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

16. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

17. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

18. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

19. The uncertainty of the job market has led to many people rethinking their career paths.

20. The uncertainty of the weather has led to the cancellation of the outdoor event.

21. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

22. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

23. This has led to a rise in remote work and a shift towards a more flexible, digital economy

24. This has led to increased trade and commerce, as well as greater mobility for individuals

25. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Nasaktan siya nang salatin ang mainit na kawali.

2. Ito ang barangay na pinamumunuan ni Datu Diliwariw.

3. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

4. Pabili ho ng isang kilong baboy.

5. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

6. Marami sa mga bayani ay nakatanggap ng pagkilala at parangal dahil sa kanilang mga naging ambag sa bayan.

7. Ang gusali sa tabi ay mababa kumpara sa bagong itinayong opisina.

8. Naglabas ako ng malalim na himutok matapos kong matalo sa paligsahan.

9. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

10. "Masaya ako na nakilala kita," ani ng bagong kaibigan ko.

11. Pinaliguan ng malamig na tubig ang bata na may bungang-araw.

12. Mapapansin kaya sa dami ng 'yong ginagawa

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Dalawampu't walong taong gulang si Paula.

15. She is cooking dinner for us.

16. Sinabi niya sa dakong huli na gusto na niyang mag-resign sa trabaho niya.

17. Nang simula ay hindi napuputol ang komunikasyon ng magkasintahan, araw araw na sumusulat ang binata sa dalaga at ganoon din naman ang dalaga.

18. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

19. Ni lumapit sa nasabing puno ay ayaw gawin ng mga taong bayan.

20. Pagkatapos, dapat mong i-mark ang mga lugar kung saan mo gustong magtanim ng mais at mag-plant ng mga buto sa mga ito

21. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

22. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

23. Maghapon nang nag computer ang kanyang anak.

24. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

25. Me encanta pasar tiempo con mis amigos jugando al fútbol.

26. Es importante tener amigos que nos apoyen y nos escuchen.

27. I have been learning to play the piano for six months.

28. A couple of students raised their hands to ask questions during the lecture.

29. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

30. Binibigyang halaga ng mga Pilipino ang talambuhay ni Ninoy Aquino bilang isang martir at simbolo ng demokrasya.

31. Sa hinaba-haba man daw ng prusisyon, sa simbahan din ang tuloy.

32. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

33. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

34. El expresionismo es un estilo de pintura que busca transmitir emociones intensas.

35. Linggo ng umaga at ang palengke ay siksikan.

36. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

37. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

38. Ako naman, poker face lang. Hahaha!

39. Ang mga estudyante ay pinagsisikapan na makapasa sa kanilang mga pagsusulit upang maabot ang kanilang mga pangarap.

40. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

41. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

42. Oo. Pero kelangan.. susunod ka lang sa akin, ok ba yun?

43. Supreme Court, is responsible for interpreting laws

44. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

45. Nagmadali kaming maglakad papalapit kay Athena at Lucas

46. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

47. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

48. I accidentally spilled the beans about the surprise trip, but she was still excited.

49. Les étudiants peuvent poursuivre des études supérieures après l'obtention de leur diplôme.

50. Sa pagbisita niya sa museo, pinagmamasdan niya ang mga antique na kagamitan.

Similar Words

dialledvaledictorianControlledbalediktoryanknowledgerolledso-calledstruggled

Recent Searches

ledconsiderarmabaitteamiosisladaddykasalukuyanbiocombustibleskumukuhapresidentialpinagpatuloybangladeshrenombrerevolucionadomahiwaganagtitindacultivopotaenanakaririmarimnanlilisikmatapobrengnegosyantenagwelgakapangyarihangnagbiyayapagkakamaliisinuotsagutinpagkaawatungkodpagkagisingkinalilibinganlondonmedikalnaapektuhantinaydaramdamintanggalinbagsaktungawhitainilalabasnabigyanisinusuottrentamarketingnalugodhinihintaynaglokohanumigtadnuevosdesign,pisaralalotalinohiramlikodpanginoonanumanvelfungerendepampagandanatutuwaadvertisingnilayuanisinumpaescuelasnakakapuntainintaydisenyoadecuadonilapitanjagiyaheartbeattondotiningnanlalaketsuperpinatiraiyakhimayinbaryosalatkinantabeforecompositorestamaandresbalatskyldesonlineelectroniclutoaralbilaomansanasanaymagisinghmmmbumotolinawcharismaticdulotsantoipatuloykaboseslegislationtwitchmadurasnakasuotcongresslamesacivilizationumingitilanganimoycanadasenateguardapicspinggantodotenderbasahannagbungasumusunomillionshanjeromeginisingcongratsmaaringmuchasrailstrengthsarilingellennutrientesgracepaakumarimotcomegagambareallyumarawsambitrelievedamingcaketiyanaggingboycreatetopicilingreturnedemphasizedstyreramazonpalamutisalamangkerasundhedspleje,bienclubindividualmakakabalikbeachbumaligtadkapitbahayprotegidoiniisiptinikpakealamgawafeltagilitylibreeksenarosasbadingdiretsahangnakuhadeliciosapinapalonaulinigannagmadalinghiwarobinhoodilalagaypaglulutoipinatawaglabinsiyambalahibocorporationsiksikannagsusulputanmurang-muranagkakatipun-tiponmerlindatinatawag