Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "connection"

1. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

2. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

3. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

4. Kailangan ko ng Internet connection.

5. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

6. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

7. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

Random Sentences

1. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

2. Iiyak ako pag hindi ka pumayag maging bestfriend ko.

3. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

4. Ingatan mo ang cellphone na yan.

5. Natawa sya, Nakakatawa ka talaga. haha!

6. Huwag mong hiramin ang aking payong dahil umuulan pa rin.

7. Sa aking balkonahe, ako ay nagtatanim ng mga maliit na halaman upang magkaroon ng kahit konting berdeng espasyo.

8. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

9. Emphasis can be used to persuade and influence others.

10. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

11. Kailangang pag-isipan natin ang programa.

12. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

13. Nous avons réservé une salle de réception pour la célébration.

14. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

15. Some limitations can be temporary, while others may be permanent.

16. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

17. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

18. Remember that the most important thing is to get your ideas and message out to the world

19. Ang paglalakad sa tabing-dagat tuwing umaga ay nagbibigay sa akin ng isang matiwasay na karanasan.

20. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

21. Ang pagpapalakas ng aking katawan sa pamamagitan ng ehersisyo ay nagbibigay sa akin ng isang matiwasay na pisikal na kondisyon.

22. Nagiging emosyonal ang mga panahon sa kasal, tulad ng mga pananalita ng mga magulang at mga kaibigan.

23. Sayangnya, acara itu sudah berakhir. (Unfortunately, the event has ended.)

24. Las plantas desempeñan un papel fundamental en el ciclo del agua, absorbiéndola del suelo y liberándola a través de la transpiración.

25. Emphasis is often used to highlight important information or ideas.

26. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

27. Napaluhod siya sa madulas na semento.

28. Buksan ang puso at isipan.

29. Beauty! yumakap pa mula sa likod ko si Maico.

30. The car broke down, and therefore we had to call for roadside assistance.

31. Las heridas que no sanan o empeoran con el tiempo pueden ser signo de una enfermedad subyacente y deben ser evaluadas por un médico.

32. Eeeehhhh! nagmamaktol pa ring sabi niya.

33. Bakit, saan ba ang iyong kaharian? malambing na tugon ng prinsesa.

34. Microscopes can magnify objects by up to 1,000 times or more.

35. See you later. aniya saka humalik sa noo ko.

36. Omelettes are a popular choice for those following a low-carb or high-protein diet.

37. Ang pabango ni Lolo ay nagbigay ng mabangong amoy sa kanyang kuwarto.

38. Waaa. Ikaw pala salarin kaya ayaw nya sa ospital!

39. Ang hirap naman ng exam nakaka bobo.

40. Inalagaan si Maria ng nanay niya.

41. Más vale prevenir que lamentar.

42. Magkapareho ang kulay ng mga damit.

43. Ipagtimpla mo ng kape ang bisita.

44. Pagod na ako at nagugutom siya.

45. Ang ganda ng sapatos ni Junjun.

46. Namnamin mo ang bawat subo ng masarap na ulam.

47. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

48. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

49. Hvis man oplever smerter eller ubehag under træning, er det vigtigt at stoppe og konsultere en sundhedsprofessionel.

50. Ang maliit na mesa ang nasa kuwarto.

Recent Searches

utak-biyaconnectionbenefits1929pakisabimasukolkumunotditodulimedisinahonestosupilinibinaoninirapanlamangnamasyalnahihilopagpapakalatlalabasnapakamotjosieexportmangpanobuwalsinunud-ssunodsumakaygymngunitanibersaryofirstminamahalhalakhakbilisluisdiliginsumimangotnaiisiplangnagawanpatientmachinesiba-ibangnakapapasonghiligtuloyoftenmagsasamaproblemasakakulisapwhileeffortscruciallinggo-linggokasamaanniyangslavegagamitinmasmakuhanakikihukaysasayawinrelievedinferioresinaasahanschoolnakikisaloluzrecordedcreateanungbutiposternandiyanmagkanopinagpatuloykidlatmatabalumindolhospitalguroganitoteamplatformsmaryquarantinepedenglugarkapamilyacantidadraymondsilabusilakmalapitnabitawanipantalopiyonagpaalamapoynadadamaydanmarkmanuksosandalimusiciankakutiskatulongpagiikotpookhorseterminosamakatwidsugaltatlongitakmagingtalagakarapatanhitiklittletotoobarung-barongnangampanyacoursesilangmagtatagaltanawnakapasokisanakikini-kinitaflamencolimosunotrycyclenamnamintinahakendmalipinaladipinagdiriwangconvertidasbakitnasunogdalirilastingsinagotlungkotnapalingontumulakmagsayangmagpa-paskoagawhintuturocitizenvictoriakinauupuannanghingiprutasclientspautangnangingilidginamitpagkalungkotsinimulannagtatrabahobagkuslenguajeedukasyonvotesmatatandaanikatandaanlumbaypagtatakatapospaitparehasearnpinatidbalitadeclaretuwingnagliwanagtrespagodchangemakakakainnausalmaputulansagotanumangmaalogpatilabananbabaingpondopaghuhugasprotestasusunod