Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "allowed"

1. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

2. Television also allowed for the creation of a new form of entertainment, the television show

3. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

4. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

5. The movie was rated R, and therefore she wasn't allowed to watch it.

6. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

7. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

Random Sentences

1. La tos crónica puede ser un síntoma de enfermedades como la bronquitis crónica y la enfermedad pulmonar obstructiva crónica (EPOC).

2. Nagdesisyon siyang mag-iwan ng trabaho upang magtayo ng sariling negosyo.

3. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

4. Binuksan ko ang pintuan ng condo ko at binuksan ang ilaw.

5. She complained about the noisy traffic outside her apartment.

6. Nandito ako sa entrance ng hotel.

7. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

8. Let's just hope na magwork out itong idea ni Memo.

9. Kainis ka talaga! sabi ko sabay hampas sa braso niya.

10. Ang reception ng kasal ay nagbibigay ng pagkakataon para ipagdiwang ang bagong kasal at kumain ng masarap na pagkain.

11. Nakita kita kanina, at nagtataka ako kung sana pwede ba kita makilala?

12. Magbantay tayo sa bawat sulok ng ating bayan.

13. Ang pang-aabuso sa teknolohiya, tulad ng cyberbullying, ay maaaring magdulot ng malubhang epekto sa mental na kalusugan.

14. The dedication of parents is evident in the love and care they provide for their children.

15. Nang suriin nila ito ay nakita ang isang insektong kumakain ng kahoy.

16. Tapos nag lakad na siya papunta sa may kotse.

17. Tengo tos seca. (I have a dry cough.)

18. I can tell you're beating around the bush because you're not looking me in the eye.

19. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

20. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

21. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

22. Bumaba na sila ng bundok matapos ang ilang oras.

23. Naging masyadong mayabang ang bata at nararapat daw itong parusahan.

24. Dalam beberapa kasus, orang tua bayi dapat meminta bantuan dukun bayi untuk merawat anak mereka.

25. Bilang paglilinaw, ang pagpupulong ay gaganapin sa online platform, hindi sa opisina.

26. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

27. I'm not impressed with his art. Paintings like that are a dime a dozen.

28. "Kung walang tiyaga, walang nilaga" ay isang bukambibig na nagpapahayag ng katotohanan na ang kakulangan ng pasensya at pagsisikap ay magdudulot ng kawalan ng tagumpay.

29. Nasi kuning adalah nasi kuning yang biasa disajikan pada acara-acara tertentu dan dihidangkan dengan berbagai lauk.

30. Naglaba na ako kahapon.

31. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

34. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

35. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

36. Pakain na ako nang may dumating na bisita.

37. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

38. The wedding photographer captures important moments and memories from the wedding day.

39. Dalawampu't walong taong gulang si Paula.

40. La serpiente marina es una especie adaptada a la vida acuática y es una de las serpientes más venenosas del mundo.

41. Hindi mo sadyang nakuha ang isang mataas na marka sa pagsusulit.

42. Matagal na napako ang kanyang tingin kay Kano, ang sumunod sa kanya.

43. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

44. Paglabas niya ng bahay, nabigla siya nang biglang umambon ng malakas.

45. Napaangat ako ng tingin sa kanya saka tumango.

46. Ang pagbabayad ng utang ay magpapakita ng pagiging responsable sa pagpapalago ng financial status.

47. Ako ay nagtatanim ng mga halaman sa aking bakuran.

48. Puwedeng gamitin ang pagguhit upang magpahayag ng mga saloobin at mensahe sa mga taong mahal mo.

49. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

50. Les hôpitaux peuvent être des environnements stériles pour prévenir la propagation des infections.

Recent Searches

alloweddingdingrobertbigyanbinabaantumatawadmalapalasyoagaw-buhayadditionallylayuanunospumasokiba-ibangnagliliyabbillnagwalisyounglatemabiromagkakaroonaabotreaksiyoninamesasalaparkevistroonmodernekumuhasinigangerhvervslivetseenkinamumuhianwalkie-talkienapakamisteryosomobilemagpapabunotkaloobangnakakapasokpakanta-kantangnakukuharessourcernepresidentialrevolucionadowashingtonmakahiramnasiyahanmagtanghaliannagpaalamsasakyanlinggongpanalanginpamilyahulunakakaanimaga-againakalamagsunogbiocombustiblesestosnasbinabarathelpsiopaonapapadaanpundidopropesormaramotmaestranagitlaniyannahantadgusalilalohalinglinghimayinpersontatlopulongkindlebilaocellphonebateryaiatftodomulighedterminoaywancallartificialpaafansnaglulusakminabutiprovideipinikityanguardareadgenerabatiyamotioncommunityginagawaexisttanodmadamisundalodinukotmaipagmamalakingtaposnagtatanongsinumangpaaralanmongnakabaonmatatandabulagpahabolkaratulangpagka-diwatacocktailbroughthappenedlalongnogensindehiramwednesdaytungkolretirarborndulacountrieskasinggandapunongkahoymagbabakasyonbagkusbangladeshnakitapagpapautanghinawakannakaririmarimkapangyarihangtobacconagbiyayapaalamkapataganfulfillmentsiyudadpaskomakatatlonapakamotpinaghatidanhumansmakukulayvillagemahinangmagdoorbellpwestoempresasmakakabalikinagawsongsnilayuanakmangcaraballoproductskaraniwangpublicitypinilitthankdennepuedenpeppyailmentslumilingonlaybrarimalayangtinataluntonkaninangtanghalipunsomeaningweremadurasumingitgrewbio-gas-developingsalitamatangnuonsumusunosteveuridatiwatchlabahinnilutochange