Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "allowed"

1. Her lightweight suitcase allowed her to pack everything she needed for the weekend getaway without exceeding the airline's weight limit.

2. Television also allowed for the creation of a new form of entertainment, the television show

3. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

4. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

5. The movie was rated R, and therefore she wasn't allowed to watch it.

6. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

7. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

Random Sentences

1. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

2. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

3. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

4. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

5. Napakabuti ng doktor at hindi na ito nagpabayad sa konsultasyon.

6. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

7. A quien madruga, Dios le ayuda.

8. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

9. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

10. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

11. Come on, spill the beans! What did you find out?

12. Paglingon ko, nakita kong papalapit sakin si Lory.

13. Pinayuhan siya ng doktor tungkol sa pangangalaga sa bungang-araw.

14. Dahil dito, walang may gustong makipagkaibigan sa kanya.

15. Investing refers to the process of allocating resources with the expectation of generating a profit.

16. Ang pagguhit ay isang paraan upang maipakita ang iyong talento.

17. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

18. The artist painted a series of landscapes inspired by her travels.

19. Walang anuman saad ng mayor.

20. Last full show tayo. Ano bang pinakamalapit na mall?

21. Las serpientes tienen una lengua bifurcada que utilizan para captar olores y explorar su entorno.

22.

23.

24. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

25. He's known to exaggerate, so take what he says with a grain of salt.

26. Eh? Considered bang action figure si spongebob?

27. The credit check for the apartment rental revealed no red flags.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Tumugtog si Jemi ng piyano kahapon.

30. They volunteer at the community center.

31. Esta comida está bien condimentada, tiene un buen nivel de picante.

32. Pinagalitan niya ang matanda at tinulak-tulak ito.

33. Puwede kang magguhit ng mga larawan ng iyong pamilya at kaibigan upang ipakita ang pagmamahal sa kanila.

34. Napakalaking ahas ang nakita ni Anjo.

35. Mga nuno, patawarin po ninyo ang aking anak.

36. Walang telebisyon sa kuwarto ni Fiona.

37. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

38. Biglang bumangon ang hari at hinugot ang espada.

39. Nakikita ko ang halinghing ng mga bata habang naglalaro sa parke.

40. Mababaw ang swimming pool sa hotel.

41. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

42. Nawalan kami ng internet kaninang madaling araw.

43. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

44. Halos anim na oras silang naglakad paakyat ng bundok makiling.

45. Matapos ng ilang araw ito ay namulaklak.

46. Ipinakita ng pamilya ni Maria ang kanilang pagtanggap sa pamamamanhikan ng pamilya ni Juan.

47. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

48. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

49. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

50. Nami-miss ko na ang Pilipinas.

Recent Searches

niceandreallowediginitgitmuchcreationbakebringingbinabajuniomaputishoeszebraangkanminutehimayinnahantadoverbeendisposalsiopaoalas-dosmakahiramkinamumuhianpayatpaboritocallpositionertennisdetteabovelastingpagsisisisakalingnegro-slavestv-showsmagtagotakotmallsnaisfulfillingtanganmorningpagongmabutisinakoppagpapautangasimsumugodbrasostonehamdaigdignasiyahannakilalaperyahanuniversitytahananyouthyumuyukohinahanaptumaposmahinasundalolalabhanpagkaangatunibersidadkakuwentuhaninilingnangagsipagkantahannakakapamasyallaki-lakirelyunahinmahiwagangsakristanpanghihiyangnanahimiknamumulotgulathinawakanmiratatawaganerhvervslivetpagsalakayhinugotsabadongkubobinuksanguestsmagpalibrepagkamanghapulang-pulapakikipagtagpomagbabakasyonnakikilalangadvertising,nagmakaawapunongkahoytinungonakabaonmabigyaneksport,pantalontinanggalmagpakaramiparusahanmarangalpumikitipinauutangsamantalangnilamabihisanmakukulaybisitamensahehulunagliwanaguugud-ugodnaiyakikukumparamagkapatideleksyonpalayohacernapadaangownindependentlylilikotatlongbanlagnauntognapadpadpanatagtiningnanthankkaarawaniconsbecamefresconatagalankasoynenaanariyanmariasusunodanayaniyabevareailmentstaassawapabalangbinasasumakaylaybraripataybusylipatpa-dayagonaldespuesrememberedreynabumuhosbuhokbaguiogulanghabitdustpanperwisyosinisinanggagamotnilimasjolibeematulogmadamiallottedsubalitiniwanteleviewingbinawisigaaabotkapetransmitsarbejderiniinomtogethermeeteeeehhhhsinongmillionsmaalognatingalaalingredesmalagopinalutowideipapahinga