Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

68 sentences found for "work"

1. After months of hard work, getting a promotion left me feeling euphoric.

2. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

3. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

4. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

5. Coffee shops and cafes have become popular gathering places for people to socialize and work.

6. Different types of work require different skills, education, and training.

7. Effective communication and teamwork are important for a successful and productive work environment.

8. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

9. Einstein's work also helped to establish the field of quantum mechanics.

10. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

11. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

12. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

13. Einstein's work led to the development of technologies such as nuclear power and GPS.

14. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

15. He drives a car to work.

16. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

17. He is driving to work.

18. He is not driving to work today.

19. He was busy with work and therefore couldn't join us for dinner.

20. Hendes ansigt er som et kunstværk. (Her face is like a work of art.)

21. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

24. I am not working on a project for work currently.

25. I am working on a project for work.

26. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

27. I took the day off from work to relax on my birthday.

28. I'm going through a lot of stress at work, but I'm just trying to hang in there.

29. I've got a big presentation at work today - I hope I don't break a leg!

30. If you keep cutting corners, the quality of your work will suffer.

31. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

32. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

33. Instagram has become a platform for influencers and content creators to share their work and build a following.

34. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

35. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

36. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

37. Many people work to earn money to support themselves and their families.

38. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

39. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

40. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

41. Nagwo-work siya sa Quezon City.

42. Ok. Free ka ba after work? Favor lang sana please.

43. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

44. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

45. Receiving recognition for hard work can create a sense of euphoria and pride.

46. Revise and edit: After you have a complete draft, it's important to go back and revise your work

47. She admires her mentor's leadership skills and work ethic.

48. She admires the philanthropy work of the famous billionaire.

49. She does not procrastinate her work.

50. She missed several days of work due to pneumonia and needed to rest at home.

51. She surprised me with a cake on my last day of work to bid me farewell.

52. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

53. Stop crying and pull yourself together, we have work to do.

54. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

55. Technology has also had a significant impact on the way we work

56. The nature of work has evolved over time, with advances in technology and changes in the economy.

57. The relationship between work and mental health is complex and can vary from person to person.

58. This has led to a rise in remote work and a shift towards a more flexible, digital economy

59. Time management skills are important for balancing work responsibilities and personal life.

60. We finished the project on time by cutting corners, but it wasn't our best work.

61. We have a lot of work to do before the deadline.

62. Work can also have a social aspect, providing opportunities to meet new people and make connections.

63. Work can also provide opportunities for personal and professional growth.

64. Work can be challenging and stressful at times, but can also be rewarding.

65. Work is a necessary part of life for many people.

66. Work-life balance is important for maintaining overall health and wellbeing.

67. Writing a book is a long process and requires a lot of dedication and hard work

68. You can find freelance writers who are willing to work for cheap rates, but good ones are not a dime a dozen.

Random Sentences

1. Napuno ng mga tao ang mga lansangan, kaya't ang lungsod ay hitik sa kasiyahan sa selebrasyon ng pista.

2. Hindi ako pumapayag sa kanilang plano dahil nakikita kong mayroong mga posibleng panganib na maaring maganap.

3. Masama pa ba ang pakiramdam mo?

4. Ang marahas na pag-atake ay labag sa batas at maaaring magdulot ng malubhang parusa.

5. The United States has a system of federalism, where power is divided between the national government and the individual states

6. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

7. Hoy en día, el internet es una parte integral de la vida cotidiana.

8. Las serpientes hibernan durante los meses más fríos del año, reduciendo su actividad metabólica y buscando refugio en lugares protegidos.

9. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

10. Les maladies chroniques sont souvent liées à des facteurs de risque tels que l'âge, le sexe et l'histoire familiale.

11. Ayaw mong magkasakit? Kung gayon, dapat kang kumain ng masusustansyang pagkain.

12. Sa gitna ng pagdiriwang, naroon pa rin ang kanyang hinagpis na pilit niyang itinatago.

13. Kakain ako ng spaghetti mamayang gabi.

14. Paano mo nalaman? tanong ko sa kanya.

15. There were a lot of toys scattered around the room.

16. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

17. Mahusay siya sa komunikasyon at liderato, samakatuwid, siya ang nahirang na bagong presidente ng organisasyon.

18. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

19. A series of earthquakes hit the region, causing widespread damage.

20. Nagluluto si Tess ng spaghetti.

21. Naglakad ang mga sundalo sa kalsada nang limahan.

22. Mahirap magtiis kung mahal mo sya.

23. Magkano ang isang kilong bigas?

24. May masakit ba sayo?? Ok ka lang ba?

25. My mom always bakes me a cake for my birthday.

26. Aller Anfang ist schwer.

27. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

28. Bakit hindi kasya ang bestida?

29. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

30. Anong ginagawa mo? nagtatakang tanong ko.

31. Ang tag-ulan ay isa ring panahon ng pagsusulat, pagbabasa, at panonood ng mga pelikula dahil sa hindi madalas makalabas ng bahay.

32. Regular grooming, such as brushing and bathing, is important for a dog's hygiene.

33. Nasa likuran lamang niya ang nagsalita.

34. Hindi maitatago ang hinagpis ng bayan sa pagkamatay ng kanilang minamahal na lider.

35. Bigla ang pagbabago ng anyo ni Magda at Damaso.

36. The traffic on social media posts spiked after the news went viral.

37. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

38. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

39. La creatividad es fundamental para el desarrollo de ideas innovadoras.

40. Hindi ko kayang mabuhay ng mayroong agam-agam sa aking buhay.

41. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

42. No me gusta el picante, ¿tienes algo más suave?

43. Kapag nakuha na niya ang aking puso saka lamang siya magkakaroon ng kapangyarihan sa mga nilalang dito.

44. Beauty! yumakap pa mula sa likod ko si Maico.

45. Sumakay sa jeep ang mga pasahero nang limahan.

46. Ang mumura ng bilihin sa divisoria.

47. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

48. Sa paligid ng balde, nakikia niya ang kanyang anino.

49. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

50. Eto namang si Kuya di na mabiro! Bagay na bagay kaya kayo!

Similar Words

workshophomeworkNagwo-workworkingmagworkfireworksworkdayUpwork

Recent Searches

worknapaangatcadenaearlynicobulakalakagadmadungischangedmasokcafeteriaimportantetigrewasakpakelamagricultoressalbahepanatagtaga-ochandofull-timeanyindustryipinagbilingumulanrelevantkinasisindakanalimentomanualpacenagbabagaamingbalangnapagsilbihanhimutokmatandang-matandahjemengkantadangmagpahingapakibigyanisipinpinangalananghayaansuwailmaibigaynagrereklamonaghihikabmaghahatidbyggethimihiyawkinakaligligmathpinagwagihangtog,babalikmatayogasawaniznameeuropekalikasaninvestlalargaseriousdioxidekumidlatkenjisalatsumapitmahinanglaganapenglishfreeyearssaringisinilangnapaintyainpagkagisingcausesskabepagpapaalaalapopularizediettalentcnicoteleponobackipinagbibiligasolinasundhedspleje,existnagmadaliinspirationdogsejecutandettegiraymagpapabunotabopupursigiinfluentialpartshaveformsmaximizingafterinvolvevaledictorianmag-isanglalamalisanreadmatandayangnagtataemusthablabapanalonabuonakapikitnapailalimtatayosapatoswatawatpinaoperahanbilerkamicallermaghistoriastageomfattendeitinapontiningnansentencekanilangrolandlawsthanksgivingpahirapanyourself,gustoinyomagtiispaanag-away-awaytresnasanseekanthonyyaripicsnaminmaramotsarilinglumipatscientificestospabalikboxingnagaganapganapinmultohayopkalalakihanblusangidolwonderumiyakmataasexhaustionnangangalognapakatagalipinasyangprocesseroplanoanubayangumuglongkumampidonationsluispeperestauranttimetelebisyonkalawangingparangbutihingsurroundingshumahangositohagdanantechniquesisasamapasadyaabangpagdamimini-helicopteruseinyong