Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

68 sentences found for "work"

1. After months of hard work, getting a promotion left me feeling euphoric.

2. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

3. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

4. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

5. Coffee shops and cafes have become popular gathering places for people to socialize and work.

6. Different types of work require different skills, education, and training.

7. Effective communication and teamwork are important for a successful and productive work environment.

8. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

9. Einstein's work also helped to establish the field of quantum mechanics.

10. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

11. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

12. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

13. Einstein's work led to the development of technologies such as nuclear power and GPS.

14. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

15. He drives a car to work.

16. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

17. He is driving to work.

18. He is not driving to work today.

19. He was busy with work and therefore couldn't join us for dinner.

20. Hendes ansigt er som et kunstværk. (Her face is like a work of art.)

21. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

24. I am not working on a project for work currently.

25. I am working on a project for work.

26. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

27. I took the day off from work to relax on my birthday.

28. I'm going through a lot of stress at work, but I'm just trying to hang in there.

29. I've got a big presentation at work today - I hope I don't break a leg!

30. If you keep cutting corners, the quality of your work will suffer.

31. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

32. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

33. Instagram has become a platform for influencers and content creators to share their work and build a following.

34. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

35. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

36. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

37. Many people work to earn money to support themselves and their families.

38. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

39. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

40. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

41. Nagwo-work siya sa Quezon City.

42. Ok. Free ka ba after work? Favor lang sana please.

43. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

44. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

45. Receiving recognition for hard work can create a sense of euphoria and pride.

46. Revise and edit: After you have a complete draft, it's important to go back and revise your work

47. She admires her mentor's leadership skills and work ethic.

48. She admires the philanthropy work of the famous billionaire.

49. She does not procrastinate her work.

50. She missed several days of work due to pneumonia and needed to rest at home.

51. She surprised me with a cake on my last day of work to bid me farewell.

52. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

53. Stop crying and pull yourself together, we have work to do.

54. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

55. Technology has also had a significant impact on the way we work

56. The nature of work has evolved over time, with advances in technology and changes in the economy.

57. The relationship between work and mental health is complex and can vary from person to person.

58. This has led to a rise in remote work and a shift towards a more flexible, digital economy

59. Time management skills are important for balancing work responsibilities and personal life.

60. We finished the project on time by cutting corners, but it wasn't our best work.

61. We have a lot of work to do before the deadline.

62. Work can also have a social aspect, providing opportunities to meet new people and make connections.

63. Work can also provide opportunities for personal and professional growth.

64. Work can be challenging and stressful at times, but can also be rewarding.

65. Work is a necessary part of life for many people.

66. Work-life balance is important for maintaining overall health and wellbeing.

67. Writing a book is a long process and requires a lot of dedication and hard work

68. You can find freelance writers who are willing to work for cheap rates, but good ones are not a dime a dozen.

Random Sentences

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Have we missed the deadline?

3. Kumalas ako sa pagkakayakap niya sa akin.

4. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

5. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

6. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

7. Ang aming koponan ay pinagsisikapan na makuha ang kampeonato sa darating na liga.

8. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

9. Halos gawin na siyang prinsesa ng mga ito.

10. Napilitan siyang bumangon at naghanda ng pagkain.

11. Wala siyang ginagawa kundi ang maglinis ng kanyang bakuran at diligin ang kanyang mga pananim.

12. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

13. Nagsasagawa ako ng mga pagsisikap upang maging maganda ang impression ng aking nililigawan sa akin.

14. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

15. Ang ganda naman ng bago mong cellphone.

16. Pasensya naman, anak rubber shoes ako eh.

17. I don't think we've met before. May I know your name?

18. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

19. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

20. Ang gusali sa tabi ay mababa kumpara sa bagong itinayong opisina.

21. Sa loob ng aking dibdib, nagliliyab ang poot na pilit kong iniipon.

22. La historia del arte abarca miles de años y se extiende por todo el mundo.

23. "A dog is the only thing on earth that loves you more than he loves himself."

24. Ayan sasamahan ka na daw ni Kenji.

25. I've been driving on this road for an hour, and so far so good.

26. Kapag mayroong sira sa ngipin, kailangan ng agarang aksyon upang hindi lumala pa ang problema.

27. The photographer captured a series of images depicting the changing seasons.

28. Sa daan pa lamang, bago siya pumasok ng tarangkahan, ay natatanaw na niya ang kanyang anak na dalaga na nakapamintana sa kanilang barung-barong.

29. May kahilingan ka ba?

30. Ang pasya nang pagkapanalo ay sa tela ng matanda.

31. Lumibot sila sa kagubatan upang masulyap ang kagandahan ng kalikasan.

32. Mahirap magpapayat kapag mahilig ka sa pulotgata dahil ito ay sobrang tamis.

33. Controla las plagas y enfermedades

34. Ang pag-asa ay nagbibigay ng mga oportunidad para sa mga tao upang maabot ang kanilang mga pangarap at mga layunin sa buhay.

35. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

36. All these years, I have been learning and growing as a person.

37. Sapagkat misyunero, marami ang naliwanagan sa katotohanan.

38. Malaki ang kama sa kuwarto ni Olivia.

39. Pero gusto ko nang umuwi at magpahinga.

40. At følge sin samvittighed kan nogle gange kræve mod og styrke.

41. Pinagtatalunan nila kung sino ang mas may karapatang manirahan sa malago at mayamang kagubatan.

42. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

43. He practices yoga for relaxation.

44. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

45. Saan nagtatrabaho si Roland?

46. Nag-aaral ako para sa aking mga eksaminasyon, bagkus ang mga kaibigan ko ay nag-aaya ng lakad.

47. Biglang dumating ang araw ng kanyang pagsusulit, naging abala si Nicolas sa kanyang pag-aaral kaya hindi siya nakakasulat at nakakadalaw sa dalaga.

48. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

49. Ang aso ni Lito ay mataba.

50. Makapiling ka makasama ka.

Similar Words

workshophomeworkNagwo-workworkingmagworkfireworksworkdayUpwork

Recent Searches

workipinalutoeithertermclassmatecreatingsilid-aralannanlalambotnagpagupitslavekingdombakitengkantadainangtunayperpektingkapwanagmasid-masidsiguradocomputere,growthsenatekontratahunisaktannagsamajeetalagangpinagkakaabalahaniniisipbosesnakaka-bwisitestateiigibprincearoundsamfundbahay-bahayangrankinasisindakanmedya-agwapagkaraaipinansasahogmariokarnabalenforcingcuentanbobobangladeshhitsuraproductsngumingisimananakawsunud-sunodkapangyarihangpanindangbayaninginiindabunutaninventiongardenmatacoaleducationpaki-basamanuksobasahancupidutak-biyaservicesrelievedincludeinspiredsteamshipsxviimakisuyokamalianumiwaspadalasnaiinistamarawgarbansostradisyondaramdaminactorsparkresumenpublicationcomunicantuluy-tuloyalas-dosnapakahangadumipagkakatuwaanmagsalitakasalukuyansundhedspleje,mabangiskatuwaani-rechargesagasaankare-karekapamilyapaanongdiscipliner,parehonghouseholdstools,nagtungorenombrenag-aalangannagbanggaanpagpasensyahansaranggolaespecializadasmagkaibigannagkitabarung-barongalas-tresluluwashinimas-himasinilalabasnapakasipagkuwartomagbayadnakatirakinakabahanmagagandangmaihaharaptumahimikmadalaspagdudugomakikitulogtumahandiwatakalakitumalimtotoongtanggalinnaapektuhannapakalusogproductividadmagkasakitmamalaspaglulutokinalilibingantutungomangahasnaiilangmungkahinapatigilpumilikomedorpunung-kahoypagsayadbinentahanmahuhulikapitbahaykumampipisngikuwentofactoresnaaksidentegumuhitmabibingibahagyangpromiseendvideremaibamaya-mayakoreainspirationsandwichbibilhincitybibilisinisisahodipinangangakpaakyatberetipaki-bukasbranchesinspiremaghahandanapagodlaranganpulonginstitucionesbinatilyoenglandbulongbobotonaglabanandefinitivomarangyangnegosyonapansinnamasinungaling