Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "song-writing"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Emphasis can be used to provide clarity and direction in writing.

3. He has been writing a novel for six months.

4. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

5. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

6. I am writing a letter to my friend.

7. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

8. Nanalo siya sa song-writing contest.

9. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

10. Sinubukan kong magpakilig sa aking nililigawan sa pamamagitan ng pagkanta ng isang love song.

11. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

12. The song went viral on TikTok, with millions of users creating their own videos to it.

13. They are not singing a song.

14. They are singing a song together.

15. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

16. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

17. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

18. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

19. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Sa dakong huli ng aking buhay, sana ay masabi ko na nagawa ko ang lahat ng gusto kong gawin.

2. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

3. Isang araw sa kainitan ng tanghali, isang mahiwagang babae ang dumating at kumatok sa mga pintuan ng mga taong bayan.

4. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

5. Ilang araw ang reservation natin sa hotel?

6. My birthday falls on a public holiday this year.

7. Le jeu est une forme de divertissement dans laquelle on mise de l'argent sur un événement aléatoire.

8. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

9. Users can like, react, or share posts on Facebook to show their engagement and support.

10. Nakapaglaro ka na ba ng squash?

11. Every cloud has a silver lining

12. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

13. Si Ben ay malilimutin pagdating sa mga petsa ng okasyon, kaya lagi siyang may kalendaryo.

14. Sino pa, isisingit ni Ogor, di si Dikyam!

15. Scientific research has shown that meditation can have a positive impact on mental health.

16. Ang mga marahas na laban sa karapatang pantao ay dapat labanan at iwaksi.

17. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

18. Ano ang ginawa ni Tess noong Marso?

19. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

20. Hindi ako sumang-ayon sa kanilang desisyon na ituloy ang proyekto.

21. El que mucho abarca, poco aprieta. - Jack of all trades, master of none.

22. Confocal microscopes use laser technology to create 3D images of small structures.

23. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

24. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

25. Maaaring magbago ang pulitika ng isang bansa dahil sa digmaan.

26. Ang pag-asa ay nagbibigay ng positibong pagtingin sa buhay at mga pangyayari kahit na may mga suliranin at pagsubok na kinakaharap.

27. Ang paglalakad sa kalikasan at pakikisalamuha sa kalikasan ay nakagagamot sa aking isip at katawan.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Ang pagpapakain ng mga biko at tikoy ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

30. Marami akong agam-agam sa aking mga plano dahil sa mga hindi nakasiguraduhan sa buhay.

31. Tahimik ang buong baryo sa takipsilim.

32. Ang hinagpis ng mga nawalan ng tahanan ay ramdam sa kanilang pananahimik.

33. May lagnat, sipon at ubo si Maria.

34. A couple of phone calls and emails later, I finally got the information I needed.

35. Bukas ay pumunta daw po kayo sa school sabi ng aking teacher.

36. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

37. Sudah makan? - Have you eaten yet?

38. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

39. Nagpipiknik ang pamilya namin kung maaraw.

40. Los sueños son la manifestación de nuestra creatividad y nuestra capacidad de imaginar un futuro mejor. (Dreams are the manifestation of our creativity and our ability to imagine a better future.)

41. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

42. The momentum of the rocket propelled it into space.

43. Humayo kayo at magpakarami! ayon ang biro ni Father Ramon.

44. I know things are difficult right now, but hang in there - it will get better.

45. Pupunta lang ako sa comfort room.

46. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

47. May tawad. Sisenta pesos na lang.

48. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

49. He is running in the park.

50. Pumupunta ako sa Negros tuwing Abril.

Recent Searches

napapalibutansong-writingpinapakiramdamantinulak-tulaknanlilimahidmagnakawnalulungkoteskuwelahanpulongngumiwipinagawauugod-ugodnagpepekelumakaskinikilalangtumawagkapatawaransinasakyantatayomahuhusayibibigayumiyakhurtigerekahongdropshipping,kumirotsasakyanbyggetmateryalesdyipniintindihinnapilipumulotkristotrentamagkanonagbentacountrypakikipaglabannakapagproposenatuwanamuhaykinakaligligamokakauntogpagpapasakitkaringadvancedkalakimang-aawitheartbeatlupainkakayanangsandalingkambingpangakoydelserdalawinkulisappagsidlandalawangadditionkararatingmeronentrancematandang-matandakendtkwebabarrocomaariredigeringparangemocionalhousestomalambingnaggalafamehuwebesmangingisdamabaitsiglochickenpoxcarriespelikulanapapatingintamissumisidsakimmatipunomachinesbalik-tanawmalumbaypaksapadaboghverstruggledadobobahaykuyamagbigayanlipadbangkowatermasdansellsearchsnobcontent,ilogclientsjudicialweddingbairdgrewhidingkuryentesikmuramuysilid-aralanexperiencesspecializedsaringhallcoaching:icongreenbaulmisusedsumindiflexibleloriideadigital1982likelyenforcingipinacesartificialfindipasokcontinuesibabasanmensahelenguajemandirigmangprogramaefficientrepresentativestartedconvertingeditorclassmateremotebitbitconstitutioninfluenceestablishednakakarinigbalediktoryanpaydagatmakisigumiwashigupinpinuntahannaglalatanghardinchamberspinaghalomanghikayatiwanpalapagnakablueimbeskapitbahayinihandanapalitanglegislationlingidnakakapasoklumiwanagupworkikinalulungkotpinatidnagsusulatkagubatanmabibingimakakakaensakopmangingibighinimas-himasformaskasawiang-paladnaiinggitnagre-reviewnaaksidenteparoroona