Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "song-writing"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Emphasis can be used to provide clarity and direction in writing.

3. He has been writing a novel for six months.

4. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

5. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

6. I am writing a letter to my friend.

7. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

8. Nanalo siya sa song-writing contest.

9. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

10. Sinubukan kong magpakilig sa aking nililigawan sa pamamagitan ng pagkanta ng isang love song.

11. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

12. The song went viral on TikTok, with millions of users creating their own videos to it.

13. They are not singing a song.

14. They are singing a song together.

15. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

16. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

17. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

18. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

19. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Comer saludable es una forma importante de cuidar tu cuerpo y mejorar tu calidad de vida.

2. Kung walang tiyaga, walang nilaga.

3. Ang pusa ay naglaro ng bola ng sinulid buong maghapon.

4. Hinampas niya ng hinampas ng kidkiran ang binatilyong apo.

5. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

6. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng tamang pag-iisip, kaalaman, at tiyaga.

7. Piece of cake

8. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

9. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

10. Pumunta kami sa Cebu noong Sabado.

11. Matapos ang kanyang tagumpay, si Hidilyn Diaz ay tumanggap ng maraming parangal mula sa gobyerno at pribadong sektor.

12. Ang maliit na aso ay tuwang-tuwang hinahabol ang bola.

13. Les personnes ayant des motivations différentes peuvent avoir des approches différentes de la réussite.

14. He is not having a conversation with his friend now.

15. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

16. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

17. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

18. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan kemauan untuk beradaptasi.

19. The bakery specializes in creating custom-designed cakes for special occasions.

20. Nous allons avoir un photographe professionnel pour immortaliser notre mariage.

21.

22. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

23. Tuwid ang tindig nito at halos hindi yumuyuko kahit may pasang balde ng tubig; tila sino mang masasalubong sa daan ay kayang-kayang sagasaan.

24. Kapag nakuha na niya ang aking puso saka lamang siya magkakaroon ng kapangyarihan sa mga nilalang dito.

25. Limitations can be challenging, but they can also inspire creativity and innovation.

26. Lumiwanag ang silangan sa pagsikat ng araw.

27. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

28. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

29. Hindi ka lang nabigyan ng pansin nag tatampo kana!

30. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

31. Ang tunay na kaibigan ay maasahan sa oras ng kagipitan.

32. Min erfaring har lært mig, at tålmodighed er en dyd.

33. Hinahanap ko si John.

34. I love to eat pizza.

35. I like how the website has a blog section where users can read about various topics.

36. The billionaire was known for his charitable donations to hospitals and schools.

37. Anong pangalan niya? Maganda siya ha.

38. Ang mahal na ng presyo ng gasolina.

39. Ang mga estudyante ay pinagsisikapan na makapasa sa kanilang mga pagsusulit upang maabot ang kanilang mga pangarap.

40. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

41. Agad na kinuha ni Mang Kandoy ang kanyang itak at tinaga ang mangkukulam.

42. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

43. Los Angeles, California, is the largest city on the West Coast of the United States.

44. Nag-aral ng kasaysayan ang estudyante.

45. "Ang kabataan ang pag-asa ng bayan," ani ni Jose Rizal.

46. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

47. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

48. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

49. Hinimas-himas niya yung likod ko pagkalapit niya saken.

50. O sige, humiwa sya sa karne, pumikit ka.

Recent Searches

mangangahoysong-writingnakaluhodikinasasabikyumabangpaghaliknaglulutojuegostitamagpagupitnagbentacountryinuulammaasahanmagtatanimhawaiitagpiangbinentahanorkidyaspahabolisinusuottaosnilalangpnilitlaamanginstituciones3hrskapalmaghapongmatutongoperativosmaibigaylolainstrumentalbookssalbahetomorrowjennydiapernahulogtabakomunikasyoncitysakoplaganappalamutipaglingonmanonoodpauwitraditionalipongcommunicatemarkednothingworkdaydulastudiednapipilitanngunitstoinvitationsitawtusindviscarloeducativassinimulanmangingisdakongipinasyangbinilhanatincontestcongressguhitkwebaweddingpagsusulatbranchesabstainingdogspecializednilanglateikatlongkarnabalbigpinunitkararatingtransitadvancedtypenutsscalehalosreleasedextraoverviewlahattherapylumakingcommercialpangitnagre-reviewindiasukatpagamutanharapannatutulogbihasasaannyoallergykayodropshipping,intsik-behopagbatiitinanimsipaumigibeuphoricdagat-dagatansementeryosermagtakabroadcastingenerginanlalamigihahatidnakakasamapapanhikkayang-kayangkaaya-ayangespecializadastaga-nayonkatutuboumiimikpananglawnagdadasalbagsakgumagamitmatiyakpalasyobilibidlungsodkesonagsilapitnagbagopinauwipasaherokapintasangnapahintotennismagdamagconclusion,maya-mayapadalasmakakanasilawvictoriadakilangtenidoasahansampungdumilatairplanestayobesesmabutimaglabakinalimutanmasukolmalawaktuvorabbaricolunespalibhasaprosesodreamnakapuntapetsangyarikokakinterestsdefinitivotelangsumabogsweettaposkadaratingmoderneagaamongfuryfertilizerseektonmalimitrichglobal