Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "spa"

1. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

2. Ang pagbisita sa isang silid-pahinga o spa ay nagbibigay sa akin ng isang matiwasay na karanasan ng kalinisan at kaginhawaan.

3. Bis später! - See you later!

4. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

5. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

6. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

7. Nagpamasahe ako sa Boracay Spa.

8. Nagpamasahe siya sa Island Spa.

9. Nous avons choisi une chanson spéciale pour notre première danse.

Random Sentences

1. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

2. The uncertainty of the situation has made it difficult to make decisions.

3. The king's family and heirs are often closely watched by the public and the media.

4. The host introduced us to his wife, a beautiful lady with a charming personality.

5.

6. Ang Ibong Adarna ay may mahabang kwento na puno ng kaguluhan at kababalaghan.

7. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

8. Dahil sa biglaang pagkawala ng kuryente, hindi ako makapagtrabaho kanina.

9.

10. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

11. Anong award ang pinanalunan ni Peter?

12. Les patients peuvent être autorisés à quitter l'hôpital une fois leur état de santé stabilisé.

13. Dapat natin itong ipagtanggol.

14. Ang bawat mabangong lasa sa kusina ay nagpapahiwatig ng isang masarap na handa.

15. Ang kahulugan ng duli ay tinik pagka't siya ay laging nagbibigay ng ligalig sa kanyang mga kaaway.

16. Yeah. masayang sabi ni Chad with matching thumbs up.

17. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

18. Ang paglapastangan sa kalayaan ng pamamahayag at malayang pagpapahayag ay isang pagkitil sa ating demokratikong prinsipyo.

19. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

20. Les patients hospitalisés doivent souvent rester alités pendant une période prolongée.

21. Masarap ang litson kaya lang nakakataba.

22. Ayaw ko magtangkang magbiyahe nang walang mapa.

23. She has been learning French for six months.

24. May dalawang kotse sina Dolly at Joe.

25. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

26. Ang daming bawal sa mundo.

27. Mayroong mga bayani na hindi kilala ngunit nagawa nilang magpakumbaba at maglingkod sa bayan.

28. She reads books in her free time.

29. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

30. Ella yung nakalagay na caller ID.

31. Hindi ko pa nababasa ang email mo.

32. La película produjo una gran taquilla gracias a su reparto estelar.

33. Ang kanyang boses ay napakahinahon at mababa.

34. ¿En qué trabajas?

35. Sa paglalakad sa gubat, minsan niya ring naisip na masarap maglakad nang nag-iisa.

36. She enjoys drinking coffee in the morning.

37. Nagsusulat ako ng mga liham ng aplikasyon upang mag-apply sa trabaho o scholarship.

38. If you want to get the best deals at the farmer's market, you have to be the early bird.

39. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

40. Football is a popular sport for both men and women, with many professional women's leagues around the world.

41. The train was delayed, and therefore we had to wait on the platform.

42. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

43. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

44. Sa labis na pagkagalit ipinadakip mismo ng datu sa mga nasasakupan ang misyunerong nangangaral.

45. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

46. The ad might say "free," but there's no such thing as a free lunch in the business world.

47. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

48. Sumakay sa jeep ang mga pasahero nang limahan.

49. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

50. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

Similar Words

spaghettinageespadahanespadaespanyolEspanyangsparknewspaperstransparentspansEspaspare

Recent Searches

compartensumangmalapitspaforcesitinalibagnangapatdansumisilipplagasmissiontagaroonpalakanegosyoheartbreakmaghahandabooksrestawranlipathinaboliyakracialatensyonkendialamidpanindangaffiliatebalangangkanboholpaskongsonidolimitedstruggledmalikotsoundmaidpigingvivapagputipagka-maktolformasmapuputicebuhumanosamonglaylaygranlabanklimalargerzoompropensodalawgreatpsh1980dinalawawitbadinginteriorcomputeresamabringimproveseencouldcontinuesidea:ipapainitimagingabspersonsislakartonconvertidaswikatumubongnamnaminkitatilanagtitindaworkshopprogramasystemyeahbehaviorandroidrepresentedflashoftentypesaffectmuchcreationscaleviewhardinjannagmistulangkatagangyourself,sagotsumingitmayikinagalitnagwikanggainmagpagkuwasumpanasabieksport,humpaymarilougripohastaarguekuwentomedyopwedeitshotelfe-facebookchickenpoxmatitigaskuwebabundokhanginpinatirao-orderapologeticpa-dayagonalmakulitbandakasamapaldamatipunobotomaarihehesalatillpalapit192900amanitosentencebingoscottishnagdarasalpumatolfauxpepeantokparanuoncommissionbaulsoresakinlegendsbobosumabogmabilisbernardotuwangaywan1000fiaresignationmaghilamospalakolgraduallybathalawouldimpactedactiondigitalfullhimiginternetbinababeginningnasundotruepracticadolayunincesdaratingclientsdiliginhiligmangkukulampinagmamasdanpamilihanrebolusyonpaki-drawingteknologihiwa