Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "images"

1. But television combined visual images with sound.

2. Confocal microscopes use laser technology to create 3D images of small structures.

3. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

4. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

5. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

6. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

7. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

8. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

9. The photographer captured a series of images depicting the changing seasons.

Random Sentences

1. The Great Wall of China is an impressive wonder of engineering and history.

2. Makapal ang tila buhok sa balat nito.

3. Wala na ang beyblade at ang may-ari nito.

4. Nagulat si Mang Kandoy sapagkat ang kulay ng dugo ng tigre ay abo.

5. L'accès à des soins de santé de qualité peut avoir un impact important sur la santé et le bien-être des populations.

6. Halos kassingulang niya si Ogor, ngunit higit na matipuno ang katawan nito.

7. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

8. Ang pag-asa ay nagbibigay ng mga oportunidad para sa mga tao upang maabot ang kanilang mga pangarap at mga layunin sa buhay.

9. I don't have time for you to beat around the bush. Just give me the facts.

10. A lot of time and effort went into planning the party.

11. Emphasis can be used to create a sense of drama or suspense.

12. A couple of friends are planning to go to the beach this weekend.

13. Nakakatawa? mataray na tanong ko sa kanya.

14. Unrealistic expectations can contribute to feelings of frustration and disappointment.

15. We should have painted the house last year, but better late than never.

16. Claro, puedes hacer todas las preguntas que quieras.

17. Naidlip siya at nang magising, nakita niya ang magandang dilag.

18. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

19. Ang mga punong kahoy ay nagbibigay ng magandang lilim sa takip-silim.

20. En boca cerrada no entran moscas. - Silence is golden.

21. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

22. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

23. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

24. Maya-maya, muling naupo at dumukot ng isang lapis at isang maliit na kuwaderno sa kanyang bulsa.

25. The event was sold out, and therefore we couldn't get tickets.

26. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

27. Salatin mo ang kahon kung may natira pang laman.

28. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

29. Frustration is a feeling of disappointment, annoyance, or anger that arises when we are unable to achieve a desired outcome.

30. O sige na nga, diba magkababata kayo ni Lory?

31. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

32. Hindi natin maaaring iwan ang ating bayan.

33. Frustration can be a sign that we need to reevaluate our approach or seek alternative solutions.

34. Ang lahat ng problema.

35. Ang pagbisita sa mga magagandang tanawin o pook turistiko ay isang nakagagamot na paraan upang mabawasan ang stress.

36. Estoy muy agradecido por tu amistad.

37. Tu peux me passer le sel, s'il te plaît?

38. Mi esposo y yo hemos estado juntos por muchos Días de San Valentín, pero siempre encontramos una manera de hacerlo especial.

39. Disente tignan ang kulay puti.

40. Samang-palad, tamad ang binatilyong apo, ayaw tumulong sa lola at, araw-araw, bumababa sa baranggay upang makipag-barkada at magsugal.

41. Sampai jumpa nanti. - See you later.

42. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

43. Les maladies mentales sont souvent mal comprises et stigmatisées dans de nombreuses cultures.

44. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

45. Napakalaki talaga ng isla sa boracay.

46. Honesty is the best policy.

47. He has traveled to many countries.

48. Nangahas siyang tumulong sa biktima ng aksidente kahit wala siyang kaalaman sa first aid.

49. Bumisita ako sa lola ko noong Mayo.

50. Argh. Parang batang bading naman eh. Anubayan.

Recent Searches

imageskalongadaptabilitynatandaanpatieuphoricleegagawinresearch:unowouldincreasesfistsputingbehaviorcontinueoktubrepagmamanehopaumanhinnanonoodrevolutionizedinteligentesgobernadortabing-dagathitsuramensajesbumuganearpagsisisicultureukol-kaytravelpooreraga-agahabitsisusuotmiyerkulesrolebanlagsementongpaaralanpabilitiemposniyanhabitbairdlandewidedagaadverselymillionskasingslaveknownamalagipagtinatawagkagandahagmatatalopinakamatapatpagtataposcultivarnagkakasyanasasakupandropshipping,businessesnaiilagannangangaraliniuwimagawasiguradoe-booksdondeisasamanabigkasdiferentesbihirangpagbatiandreanatutulogminerviesinaliksikuniversitiestelahinahaplosnatigilanumigibpelikulafrescoaksidenteasiaticlihimdangerousdaladalanagpuntakahilinganisipshowsmournedbukodmatapos1973mulighedtools,boktulongpagkamanghabisigoverviewstorebinabaanmapadalibeforebabaworkdaysafebinilingprocessrememberamountmagpa-ospitallastingkinagalitannagsisipag-uwianflyvemaskinernahintakutankapamilyamungkahimagsasakanagkasakitmagkanolumayotumamisbinabaratumokaynatitirangtarangkahankamalayanbinatilyomalilimutanhotelself-defensegreatlymatarayadvancecarmentuloyarguemedyobinasaarbejdertsesamakatwidbriefpasyaloobfloorbellperangcreatethereforetextomatabanakikini-kinitanagkakatipun-tiponpag-aalalamakapangyarihanagwadorkapasyahannakikiasalamangkeroimulatvitaminabstaining2001kulunganmasayangmahinoginuulcernaiiritangnatatawahahahapaalamkristosocialestechnologicaldealmbricoshawlabutodalawinpinoykabuhayanpuedennapapatinginsasakyanuminomnaggalahingalgag