Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "must"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. Football players must have good ball control, as well as strong kicking and passing skills.

3. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

4. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

5. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

6. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

7. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

Random Sentences

1. Paano kung hindi maayos ang aircon?

2. Mahirap magluto ng pulotgata dahil kailangan ng tamang timpla.

3. Ikinuwento niya ang nangyari kay Aling Pising.

4. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

5. Ang pagkakaroon ng positibong pananaw ay makatutulong sa pagharap sa mga hamon ng buhay, samakatuwid.

6. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

7. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

8. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

9. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

10. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

11. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

12. All these years, I have been working hard to achieve my dreams.

13. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

14. A couple of actors were nominated for the best performance award.

15. The culprit behind the product recall was found to be a manufacturing defect.

16. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

17. Nag-uumigting ang kanyang mga ugat

18. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

19. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

20. Halos lahat ng mga misa sa aming parokya ay may awiting Bukas Palad.

21. Kahit na lilipad ang isip ko'y torete sa'yo.

22. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

23. Lasingero ang tawag sa taong laging nag-iinom ng alak.

24. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

25. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

26. Ang hilig mong mang hiram ng gamit tapos di mo naman binabalik!

27. Malapit lamang pala ang pinaghatidan nito ng tubig.

28. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

29. Ang aking anak ay madalas manood ng Baby shark sa youtube.

30. He has been writing a novel for six months.

31.

32. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

33. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

34. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkasira ng mga personal na relasyon.

35. The wedding ceremony is often followed by a honeymoon.

36. Siya ay nagpunta sa simbahan, lumuhod, at nagdasal.

37. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

38. Sa harap ng outpost ay huminto ang pulis.

39. Isa-isa niyang tiningnan ang mga nakapaligid sa kanya.

40. Ang maliit na aso ay hinahabol ang anino ng saranggola.

41. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

42. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

43. ¡Muchas gracias!

44. Ngayon lamang ako nakakita ng dugo na kulay abo.

45. Remember that the most important thing is to get your ideas and message out to the world

46. Ada asap, pasti ada api.

47. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

48. Nakangiti sya habang nakatayo ako at nagtataka.

49. Hindi maaring magkaruon ng kapayapaan kung ang marahas na kaguluhan ay patuloy na magaganap.

50. Sa isang malayong pook sa Pilipinas nakatira ang mag-asawang sina Mang Kandoy at Aling Pising.

Similar Words

Kumustakamusta

Recent Searches

pinalambotmustpakibigyangagawinpasinghalnumberomfattendekoreatahanancombatirlas,gayundinkinagatgrabemag-usapsabaykatagangblazingbakasyonnunggulatmorenapreviouslyqualitydrawingninanaisbayanrenacentistangangsyangpagsahodbanlagumuulannaguusappinanawannagdaramdameverythingsinisiratinignanmanualfirstvivadingginpartynogensindenakalilipasikinasasabiknangampanyamakapangyarihannakikini-kinitaagwadordarkisulatnaibibigaykuwartonagpabayadkristomagsisimularomerotumamisnakakainhayaangpanalanginlumakashalalantumahimikkommunikererpoorerjejusumusulatnabigyannewstig-bebeintetinatanongipinambiliuwakkumantanalanghatinggabipoliticsnapapatinginpakaininhuertolittlepagsalakayproductsmagkaroonhoykirotjocelynbangkokarangalaninangbestnaggalatshirtdeterminasyonsalatinnag-asaranpaboritokagalakaniatfiniinompalaynunobairdredigeringbarrococenterresumenexcitedconditionlipadnasaangpopulationbosesvasqueschesslumakingtakeofficesoonmamalaslamesawidenamgabemamayangtanghalixixtinagamaglendpagbahingkumirotinterests,alas-diyesmasokkumilosgatheringcharitableinaapirolledumarawreaddennerelievedasiananoodharap-harapangbihiradifferentpaki-bukasweddingnanlilimahidsigningspollutionbahay-bahayshiningproductionmagpapapagodkontranaiyakinilabasusobangladeshnitongzoomphysicalcalambaanonagpadalai-rechargemegetgiyeramag-ingatmulitypeslalopigilanadecuadotherapeuticspumatolbatok---kaylamigconstitutionpinoyhawaiitiketroonbalatsakupinunosvarietycommercialincrediblenatitirangpagsidlanmasayangkinaiinisankinagalitanpinakamagaling