Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "aligns"

1. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

Random Sentences

1. Nationalism has been used to justify imperialism and expansionism.

2. Un powerbank es un dispositivo portátil que permite cargar dispositivos electrónicos.

3. Sa tuwa ng Elepante ay kumembut-kembot ito sa pag-indak.

4. La realidad es a menudo más compleja de lo que parece.

5. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

6. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

7. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

8. In the years following his death, Presley's legacy has continued to grow

9. Halos lahat ng mga misa sa aming parokya ay may awiting Bukas Palad.

10. When in Rome, do as the Romans do.

11. The hospital had a special isolation ward for patients with pneumonia.

12. Pasensya naman, anak rubber shoes ako eh.

13. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

14. Los colores cálidos, como el rojo y el amarillo, transmiten energía en una pintura.

15. Mathematics provides a systematic and logical approach to problem-solving.

16. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

17. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

18. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

19. At sa kanyang paglayas, naligaw siya sa gubat at inatake ng maraming alamid.

20. Ang carbon dioxide ay inilalabas ng mga tao.

21. Naglipana ang mga isda sa malalim na bahagi ng dagat.

22. Wala akong maisip, ikaw na magisip ng topic!

23. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

24. Sino sa mga kaibigan mo ang matulungin?

25. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

26. Dapat lamang kayong maging kauri ng hayop, ang wika ng babaeng diwata pala ng ilog.

27. Nagluto ako ng paborito kong pagkain kaya masayang-masaya ako ngayon.

28. In 1977, at the age of 42, Presley died of a heart attack

29. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

30. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

31. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

32. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

33. Les biologistes étudient la vie et les organismes vivants.

34. The momentum of the rocket propelled it into space.

35. Ano naman ang gagawin mo sa inyong hardin? wika ng binata

36. Bumili ako ng bagong set ng kubyertos para sa aming bahay.

37. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

38. Hindi malinis ang mga tsinelas ni Lori.

39. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

40. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

41. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

42. Espresso is a concentrated form of coffee that is made by forcing hot water through finely ground coffee beans.

43. Les personnes âgées peuvent continuer à poursuivre des activités et des hobbies qu'elles aiment.

44. They play video games on weekends.

45. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

46. El flamenco es un género musical y de danza tradicional de Andalucía, con raíces gitanas, que se caracteriza por su intensidad emocional y su riqueza rítmica

47. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

48. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

49. Nagtitinginan na sa amin yung mga tao sa paligid namin.

50. Helte findes i alle samfund.

Recent Searches

completealignscontrolledprobablementesmilemagpakasalmanlalakbayballhahatoladditionally,abut-abotstudiedscottishbroadcastsnaggingchickenpoxcompanykapitbahaylegacylapitanfrescobitawanlulusogcouldmakatulogdumaramipulisenforcingnapapadaanre-reviewfuturesofacallingsundaespreadtanggalinlumulusobtipmethodstiposcontinuecontrolatusonggeneratemakikitulogandroidpshmananakawmind:aidmitigateconnectingpeternamumuongmakikinigwhatsappunidosailmentsnapakamotmagagalingsinipangincludepag-aaralangteacherdrawingisinaboyawayintramurosdebateswalisgiftgayamakalawanamanpananakitpagbahinghimayinpangalananspecializedpongipantalopnaawananaisincantonakapagtapossharmainenahantadmagbungatactotatlumpungtitserworkingpahahanappaldabumuhosnangangalirangsumarapinalalayanhelpfulpaki-translaterecibircurtainskingpahiramnagtungopulasinunodlastinghinagishinoglaryngitisnagtakatumigilpinalayasidiomamasdanbroadmagdamaganbinigaynasuklamendingmakangitimanuelmarsoangalsukatkontinentengentranceeyehardine-explainnagisingmagkasinggandabinawianexhaustedmaaringpatunayanpriesttayofacebookunti-untijocelynfeelinglorimaligayamenoseducationalpinagpatuloyinterests,paglakisongssparenakatuonmoviesellsoccerpinakamahalagangpakibigaylayuannangyarikailanbutchabsmalapalasyoroleahasnatigilankagandahanhumabolpalancadibdibwatchpatakbokaaya-ayangnamumulaklakalangankwartoyeypalasyohumigaeveningpagsasalitaselebrasyonunannatinagbridegumagamitmaabutanotrasnatatanawmerrysumakitnasagutannakakapagpatibaymangingisdangtagumpayngangtag-arawnamajagiya