Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "issues"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. Ailments can range from minor issues like a headache to serious conditions like cancer.

3. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

4. Frustration can also be a symptom of underlying mental health issues such as anxiety or depression.

5. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

6. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil ito ay maaaring maging dahilan ng depresyon at iba pang mental health issues.

7. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

8. Musk has been involved in various controversies over his comments on social and political issues.

9. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

10. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

11. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

12. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

13. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

14. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

15. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

16. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

17. We need to address the elephant in the room and discuss the budget issues.

18. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

Random Sentences

1. We have finished our shopping.

2. Yan ang totoo.

3. Sa sinabi nyang yun napalingon ako ng hindi oras, Ha?!

4. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

5. Inutusan niya si Pinang na magluto ng lugaw.

6. Sa baguio nila napiling mag honeymoon.

7. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

8. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

9. La novela produjo una gran empatía en el lector hacia los personajes.

10. Kahit pagod ka na sa trabaho, nakakarelax ang paglalakad sa dapit-hapon.

11. Sweet foods are often associated with desserts, such as cakes and pastries.

12. Ngayon ka lang makakakaen dito?

13. Wala akong opinyon sa bagay na ito, kaya sa ganang iyo, ano ang pinakamainam na hakbang?

14. Ang pagbibigay ng oras at pag-aalaga sa mga alagang hayop ay nakagagamot sa aking kalooban at nagbibigay ng pagmamahal.

15. Honesty is the best policy.

16. Naramdaman kong nag vibrate yung phone ko.

17. Hindi ko alam kung paano mo ito tatanggap, pero may gusto ako sa iyo.

18. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

19. Datapwat mali sila ng akala, sapagkat ang anak ay hindi nagbago.

20. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

21. "Ang batang matalino, may alam sa lahat ng bagay" ay isang bukambibig na nagpapahayag ng husay at talino ng isang batang may malawak na kaalaman.

22. Athena ang aga aga nakasimangot ka na kaagad.

23. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

24. Tila asong nagpipilit makapaibabaw si Ogor.

25. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

26. Ang lider ng samahan ay pinagpalaluan ng mga miyembro dahil sa kanyang integridad.

27. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

28. Pumasok po kayo sa loob ng bahay.

29. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

30. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

31. Yep, basta lang ibibigay mo sakin ang araw mo ngayon.

32. Bakit ka nakitulog sa bahay ng kaibigan mo?

33. May lagnat, sipon at ubo si Maria.

34. She is not drawing a picture at this moment.

35. Palibhasa ay madalas na nagsusulong ng mga bagong ideya at mga panukala dahil sa kanyang malawak na pananaw.

36. Para sa kaibigan niyang si Angela

37. Patuloy ako sa paglinga nang may mamataan ang mga mata ko.

38. Talagang hinahangaan ni Marie ang disente nyang kasintahan.

39. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

40. Omelettes are a popular choice for those following a low-carb or high-protein diet.

41. Tinaas ko yung isang kilay ko, I'm working for him noh.

42. Sa gitna ng kaniyang pag-aaral, napadungaw siya sa katabing silid at nakita ang kanyang kaibigan.

43. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

44. Kinapanayam siya ng reporter.

45. Les personnes âgées peuvent avoir des difficultés à se déplacer ou à effectuer des tâches quotidiennes.

46. Basketball is a team sport that originated in the United States in the late 1800s.

47. Hindi dapat nating kalimutan ang ating mga pangarap kahit na nagbabago na ang ating mga prioridad sa buhay.

48. Påskedag fejrer Jesu opstandelse fra de døde og markerer afslutningen på Holy Week.

49. Ipinagbabawal ang paglapastangan sa mga pampublikong lugar tulad ng mga museo at bibliyoteka.

50. Amazon has a vast customer base, with millions of customers worldwide.

Recent Searches

restissueskumikilospostpinag-usapanposporomarketing:dulotfederalpinatutunayannapapahintonapakahusaygospelnanangisprotegidobutasvisualmatandang-matandainfusionesnagtitiissafermikaelatiismasayahinsmokingkutodejecutankaysanagiislowkananmaarishowersilbingmatchingsementode-dekorasyonreturnedinvolvekinikilalangnagandahanhitsuranalugimakaraannapakamotpinapaloalingsoremanirahanmakasalanangnagagamitpanatagnagulatintramurosnatabunanpasaheropaanganyindustrysimulagiyeralumagotog,isinaboyvitaminkastilangpaglingonpublicitymetodiskanubayantagaroonlistahaniniisipbilimalayangnakamartespunsolumulusobspaghettiofficeiconcommunitytopicbadingthoughtsinilingnagagandahankabuntisanpakanta-kantangmagagawapinasalamatantinaposkinasisindakanhayaanmaynilabukodmagsasakatinawagstoryinakalakilongnagbanggaan1970skumananmasaholjulietsakenhalinglingcashmisteryobinabaratvocalwereutilizarlifemulsigemagdaentrytalebringingnagkalapitmuranghappiereconomichinagpiskinatatalungkuangmaibigaykisapmatatinatawagpatutunguhanmagnakawtinapaymaawaingnahawakanculturetugikinapanayammagawasalbahengmahuhulimarangyangnagwikangxviinaabotpaldaincrediblerepublicanpsssmatigassundaejuneangkanpadaboglandemagpahingasumakayernanpartiessagasaanmoodfuelboholheimalinisinalalayanbeingmobileinternetgapamountbeforedamdaminipinagbibiliremembercurrentkinausapsong-writingnakakasamamaghahabihanapbuhaypalaisipannuclearitinatapatdifferentnapakalamigdiferentespinabulaanjosietumindigtenidona-curioushinampasbutoandreamag-asawaganitokatagalanaaisshcitizen