Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "entertainment"

1. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

2. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

3. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

4. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

5. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

6. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

7. Television also allowed for the creation of a new form of entertainment, the television show

8. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

9. The field of entertainment has also been greatly impacted by technology

10. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

11. The telephone has also had an impact on entertainment

12. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

13. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

14. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

Random Sentences

1. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

2. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

3. Magdamagan ang trabaho nila sa call center.

4. The nature of work has evolved over time, with advances in technology and changes in the economy.

5. Ang bagong linis na kurtina ay nagbigay ng sariwang at mabangong hangin sa silid.

6. Ang kaniyang pagsasalaysay ay animo'y isang makulay na kuwento mula sa isang librong mahirap kalimutan.

7. Ang magnanakaw na kumaripas ng takbo ay nahuli rin sa dulo ng kalsada.

8. Ah salamat na lang, pero kelangan ko na talagang umuwi.

9. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

10. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

11. Hanggang sa dulo ng mundo.

12. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

13. Sa tamis na dulot ng pag-ibig natin dalawa.

14. Kape ang iniinom ni Armael sa umaga.

15. Ang magsasaka ay nagtatanim ng palay sa bukid.

16. Sa kanilang panaghoy, ipinakita nila ang tapang sa kabila ng matinding pagsubok.

17. Mag-uusap kami sa makalawa ng tanghali.

18. The movie was rated R, and therefore she wasn't allowed to watch it.

19. Matapang si Andres Bonifacio.

20. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

21. Nag-book ako ng ticket papunta sa Ilocos.

22. Ang pagiging makapamilya ay isa sa pinakamagandang katangian ng mga Pinoy.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

25. Ang bawat tao ay may natatanging abilidad na nagbibigay kahulugan sa kanilang buhay.

26. Tesla is an American electric vehicle and clean energy company.

27. Kakutis ni Kano ang iba pa niyang kapatid.

28. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

29. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

30. Wala ho akong dinukot na maski ano sa kanya.

31. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

32. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

33. She watched a series of documentaries about the history of ancient civilizations.

34. La pimienta cayena es muy picante, no la uses en exceso.

35. Muchos agricultores se han visto afectados por los cambios en el clima y el medio ambiente.

36. Lumiwanag ang silangan sa pagsikat ng araw.

37. Anong buwan ang Chinese New Year?

38. Eine hohe Inflation kann die Kaufkraft des Geldes drastisch reduzieren.

39. Hindi mo natapos ang iyong takdang-aralin? Kung gayon, hindi ka makakakuha ng mataas na marka.

40. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

41. We have seen the Grand Canyon.

42. Tinutulan ng komunidad ang anumang uri ng abuso laban sa mga kababaihan.

43. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

44. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

45. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

46. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

47. Nagsisunod ang mga kawal sa palasyo pati ng mga nasasakupan.

48. Kapag aking sabihing minamahal kita.

49. Some people invest in cryptocurrency as a speculative asset.

50. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

Recent Searches

entertainmentpaketemaistorbosacrificekatagalanalayservicesdahilbalangblusaparkingexhaustednunaggressionmaisguhitkantomaestrohighlikelynothinghimselfbawatappbaldengstartedwritemethodskasogayunmanmalapitangayundinmidtermproducts:litomakahiramfar-reachingnagmasaktanpaaarawenfermedades,seguridadskillsmabihisandoble-karaabapangilsinasabiayaluisacupidmatsingtumatawaplaguedsquashbilindrinktessdevelopkalalarokaliwaworkmariatumatawadskyldesbingomusicalhalamangregalomaasimwalangestadosnapabalitareachoutmapapalatekamaaguadalhanikinagagalakkalagayanmagpa-checkuptambayannakitulognicomasasalubongisinasamadingdingnapabalikwassimbahanrecentlykargangrefnasimpitnakatinginbusiness,pagluluksapakakasalananimales,knowledgepakibigyankawayanmasterbintanapaglulutoeleksyonestablishnag-umpisabopolsnagtungodesarrollarontandangmasdanmaalalautusannakaratingmag-alasnapakalamigcornersnabasamahulogdumilimsuelobagyongtaga-lupanggobernadorhinahaplossanmagandang-magandadevelopmentreceptornagkakasayahanpadalasmabalikgusting-gustomaka-yostruggledpagkaimpaktonag-emailmakaratingrestawranmaalikabokyumaoginooagam-agamclientstanyagdanmarkdeletingranaynakalocknaaalalakatipunanibat-ibangpaungolconbayadnakiisawonderneromalimittanawinkinalalagyanmasaganangsanangpagkabiglatradisyonumibiginventedbigayyakapnakakaennakarinigmapagkatiwalaanyanutak-biyarenombrepalakanakapagproposebefolkningen,kakainkadalaspabalingatmahiwagangpagpapakainkawalanandyanbusyubuhinpaghahabiperlatrapikpesosisasamamasipaggananginorder