Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "while"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

3. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

4. He listens to music while jogging.

5. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

6. Scissors have handles that provide grip and control while cutting.

7. She does not use her phone while driving.

8. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

9. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

10. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

11. Some limitations can be temporary, while others may be permanent.

12. Some people view money as a measure of success and achievement, while others prioritize other values.

13. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

14. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

15. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

16. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

17. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

18. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

19. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

20. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

21. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

22. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

23. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

25. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

Random Sentences

1. Menjaga hubungan yang harmonis dan menyenangkan dengan orang-orang di sekitar kita dapat meningkatkan kebahagiaan dan kepuasan hidup.

2. Lumayo siya sa amin, waring nais niyang mapag-isa.

3. Nosotros celebramos la Navidad con toda la familia reunida.

4. Les algorithmes d'intelligence artificielle peuvent être utilisés pour optimiser la consommation d'énergie dans les bâtiments.

5. Napakaganda ng mga pasyalan sa bansang Singapore.

6. Napakalaki talaga ng isla sa boracay.

7. Natutunan ko ang mga awiting Bukas Palad mula sa aking mga magulang na parehong Katoliko.

8. Isang Saglit lang po.

9. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

10. Ang kaaway sa loob ng bahay, ay higit na nakakasakit kaysa kaaway sa labas.

11. Tumayo ako tapos tumayo rin si Carlo.

12. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

13. Ang linaw ng tubig sa dagat.

14. Eine Inflation kann die wirtschaftliche Ungleichheit verschärfen, da Menschen mit niedrigerem Einkommen möglicherweise nicht in der Lage sind, mit den steigenden Preisen Schritt zu halten.

15. Nagsisilbi siya bilang doktor upang mapangalagaan ang kalusugan ng kanyang pasyente.

16. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

17. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

18. Has she met the new manager?

19. The ad might say "free," but there's no such thing as a free lunch in the business world.

20. The feeling of finishing a challenging book can be euphoric and satisfying.

21. Nahulog ang bola sa dagat kaya lumangoy si Rico para kunin ito.

22. Malaki at maganda ang bahay ng kaibigan ko.

23. The telephone has also had an impact on entertainment

24. Ito lang naman ang mga nakalagay sa listahan:

25. Ang buhawi ay isang malakas at mapaminsalang bagyo na karaniwang nagdudulot ng malakas na hangin, pag-ulan, at pagbaha.

26. Ang magnanakaw ay nagtago sa isang madilim na eskinita matapos ang kanyang krimen.

27. Sa gitna ng kaguluhan, natagpuan niya ang kapayapaan sa pag-iisa.

28. The company lost a lot of money by cutting corners on product quality.

29. Det kan være en rejse at blive kvinde, hvor man lærer sig selv og verden bedre at kende.

30. The feeling of accomplishment after completing a difficult task can be euphoric.

31. The momentum of the ball was enough to break the window.

32. Yan ang panalangin ko.

33. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

34. It's important to maintain a good credit score for future financial opportunities.

35. Tsuper na rin ang mananagot niyan.

36. Nous allons faire une promenade dans le parc cet après-midi.

37. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

38. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

39. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

40. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

41. Buenas tardes amigo

42. Ang kahirapan at kawalan ng trabaho ay kadalasang problema ng mga anak-pawis.

43. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

44. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

45. Air tenang menghanyutkan.

46. Limitations can be viewed as opportunities for growth and personal development.

47. Makikiraan po!

48. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

49. Sa kaibuturan ng kanyang damdamin, mahal niya ang kanyang mga kaibigan.

50. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

Recent Searches

syncsourceandroidautomaticprocesswhileneedssolidifyulingeffectmapmethodsthirdcurrentinitshifthighestfallabinilingtwoexistconvertinghateworkshopitemsplatformpasinghalhalosandycontentstopalignsconsiderroughreallyawaresambitanibihiranakakatakotlcdkotseisinakripisyobansagawaduwendepapuntanag-aagawanincitamenterpanotantanankaibigantakbomagpakasalbabyconganaitinatagincludeberkeleybitbitjunjunpuntabeyondhulingbasahellolasingfencingnarininguponwouldgotmalakingaggressionrobertipongpowersdoble-karainalalayanalituntuninumanoikinamataymarketplaceskonsentrasyonnagmungkahisportsmagkasintahannakagalawnapakatalinonagtagisankinatatalungkuangpagluluksakinayageologi,nagkitanagpakitanakaliliyongnakakapagpatibaygumagalaw-galawkwenta-kwentakaloobangpaga-alalamagkaibiganmalezakumitalumalakinakatuwaangmagkakailanamulatmagasawangcarspulang-pulanakapapasongsalamangkeromagkakagustonagpapaigibnamuhayopisinananunuksokapintasangpartsmagagamitmagamotumuwimanilbihannakahainnakatitigilalagaymagpagupitnapakagandanagsuoto-onlinedesisyonannapatigilmanatilimakikitulogbatodisciplintalagamamiphysicaltemparaturapandidirinakatindigisasabadtungawimpormakikikainpinagmamasdansinasadyagagawinkalaunanmananakawpagpapasankinauupuangkapatawarandapit-haponnagkasunogkapangyarihant-shirthahahatotoomagtatakavidtstraktfrancisconasaangkaliwakaraokegumuhitbasketbolkatolisismotumaposcountrysinisiranavigationpakakasalanrenacentistahinahanapnagbentakuripotnakabluemagpakaramipabilibintanapantalongtuyokamaliansurveysnamilipittog,bangkangnabiawangpinansinpwestomagbabalasugatangperyahannaiiritangpaano