Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "while"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

3. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

4. He listens to music while jogging.

5. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

6. Scissors have handles that provide grip and control while cutting.

7. She does not use her phone while driving.

8. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

9. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

10. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

11. Some limitations can be temporary, while others may be permanent.

12. Some people view money as a measure of success and achievement, while others prioritize other values.

13. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

14. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

15. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

16. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

17. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

18. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

19. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

20. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

21. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

22. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

23. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

24. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

25. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

Random Sentences

1. Ang mga pangarap natin ay nagbibigay sa atin ng inspirasyon upang magtrabaho nang husto.

2.

3. Mayroon akong asawa at dalawang anak.

4. Gumawa siya ng eksamen para sa klase.

5. Ano ang sasayawin ng mga bata?

6. Noong una, sinasagot niya ang mga panunuksong ito.

7. Ang bayanihan ay nagpapalakas ng samahan at pagkakaisa sa aming pamayanan.

8. Napakabuti nyang kaibigan.

9. Kailangan nating magkaroon ng lakas ng loob upang tuparin ang ating mga pangarap.

10. Siya ay laging nagmamalabis sa pag-aaksaya ng pera para sa mga luho.

11. Hindi lahat ng kaibigan ay laging nandyan.

12. Inflation kann auch durch politische Instabilität verursacht werden.

13. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

14. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

15. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

16. En boca cerrada no entran moscas. - Silence is golden.

17. Agama sering kali menjadi sumber inspirasi dan motivasi bagi individu dalam menghadapi tantangan hidup dan mencari makna dalam eksistensi mereka.

18. Gusto niyang lumayo at maglakbay palayo sa lugar ng kanyang kabataan.

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. Sa kalayaan, nakakamit natin ang tunay na katarungan at pagkakapantay-pantay.

21. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

22. Nasanay na siyang salatin ang dingding para maghanap ng switch ng ilaw.

23. Mahal niya pa rin kaya si Lana?

24. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

25. Ano ang ikinamatay ng asawa niya?

26. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

27. Anong klaseng adobo ang paborito mo?

28. Kalimutan lang muna.

29. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

30. She missed several days of work due to pneumonia and needed to rest at home.

31. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

32. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

33. Kanino ka nagpatimpla ng cocktail drink?

34. Hun er min store forelskelse. (She's my big crush.)

35. Nagpapadala ako ng mga kanta at mensahe sa aking nililigawan upang ipakita ang aking pagmamahal.

36. Hun er en fascinerende dame. (She is a fascinating lady.)

37. Hormonbehandling og kirurgi kan have forskellige risici og bivirkninger, og det er vigtigt for transkønnede personer at konsultere med kvalificerede sundhedspersonale.

38. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

39. Nasa kanan ng bangko ang restawran.

40. Lumabas na rin naman ako pagkatapos.

41. "Dogs leave paw prints on your heart."

42. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

43. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

44. Ang nakita niya'y pangingimi.

45. Les enseignants peuvent être amenés à enseigner dans des écoles différentes en fonction de leurs besoins professionnels.

46. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

47. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

48. Puwede magdala ng radyo ang kaibigan ko.

49. Ang aso ni Lito ay mataba.

50. Hindi ka man makahanap ng kasama, mayroon kang kaulayaw sa loob ng puso mo.

Recent Searches

whileoftentablebehaviorcontentuniquecharitablemanagersquatterblessbroadcastsbitawanboxrightferrersyncnakasalubongexamplesedentarythirdworkshopresultrangehatefistsclassroomhumpaykasakitwhetherleestudiedpakainmagworksasagutinunti-untinakatindig1876quicklyhampaslupalumiwanagnamumulaklakjobamountumilingflightmagkaibangmasayahinsurenaglokopahiramtumamiscorporationmalulungkotnasuklamtenerpaaralankalarotatlotaxibanalattorneymaisiprelativelypagkaawaumigtadiwanandisposaldomingolipadyanlegislativefearplayedibigmamanhikanyou,kinatatakutanwakasfacilitatingpedeindividualcallingcigarettesflexiblebumibitiwnagtatakbolibreeducationalaayusinnasundocontrolledresourcespamamasyalthankablefallalabisthreeannamagisingpagkaangatsaranggoladatinakatunghayprivatebarcelonamanamis-namismahawaantemparaturasimbahanpagpapasannakauponagtungopresidentialsalamangkeropagtitiponsasayawintobaccolumikhaluluwaspinag-aralanaanhinkatuwaanhouseholdssukatpagkatakotpronounnahihilomahiwaganahintakutaniigibtatagalleksiyonphilanthropykulungannapatigilgayunmanmagbibigaysigesonglalakadnangangalitmakalaglag-pantygawinkamandagnakabibingingtagtuyottahanandissekinalalagyannanonooddotasiguradokusinainuulamrinpamagatkahongthemmasaganangtungonapakabilissaan-saanumuusighinihintaypalabasnatuwajackzsellkirbymaskinermagpakaramitumamacarbonnakasakaypigilaninfluentialtherapeuticsnanunurimahahabapapalapitlikodumuwinag-bookalintuntuninmakakakababayanasukalpusomaaksidentebloggers,saktankuliglignuonyouthnakiramaydesign,pagsusulitunangimpen