Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "care"

1. Ailments can be managed through self-care practices, such as meditation or physical therapy.

2. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

3. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

4. Eating healthy is an important way to take care of your body and improve your quality of life.

5. Haha! Who would care? I'm hiding behind my mask.

6. High blood pressure can be managed effectively with proper medical care and self-care measures.

7. Hospitalization can be a time for patients to focus on their health and receive specialized care.

8. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

9. I have been taking care of my sick friend for a week.

10. I've been taking care of my health, and so far so good.

11. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

12. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

13. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

14. It's important to provide proper nutrition and health care to pets.

15. Offering forgiveness doesn't mean we have to continue a relationship with someone who has repeatedly hurt us; setting boundaries is important for self-care.

16. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

17. Scissors should be handled with care to avoid injuries and kept out of reach of children.

18. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

19. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

20. The dedication of parents is evident in the love and care they provide for their children.

21. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

Random Sentences

1. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

2. Nasi padang adalah hidangan khas Sumatera Barat yang terdiri dari nasi putih dengan lauk yang bervariasi.

3. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

4. Alam ko.. sinabi niya sa akin yun..

5. Ohne Fleiß kein Preis.

6. Algunas heridas pueden requerir de cirugía para su reparación, como en el caso de heridas graves en órganos internos.

7. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

8. Hindi dapat natin balewalain ang pag-unlad ng ating komunidad, samakatuwid.

9. Nagmadali kaming maglakad papalapit kay Athena at Lucas

10. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

11. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

12. Tuwang-tuwa pa siyang humalakhak.

13. Nakaramdam ako ng sakit kaya hinugot ko ang aking kamay upang pumigil.

14. Les examens et les tests sont des évaluations importantes pour les étudiants.

15. Ini sangat enak! - This is very delicious!

16. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

17. Ilang tao ang pumunta sa libing?

18. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

19. "The more people I meet, the more I love my dog."

20. Nahuli na ang salarin sa kasong pagnanakaw.

21. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

22. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

23. Nasa sala ang telebisyon namin.

24. Ano naman ang gagawin mo sa inyong hardin? wika ng binata

25. Disculpe señor, señora, señorita

26. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

27. Maraming mga bata ang mahilig sa pagguhit dahil ito ay isang paraan upang magpakita ng kanilang imahinasyon.

28. Hiram muna ako ng iyong kamera para kuhanan ang mga litrato sa okasyon.

29. Masyado ka naman nagpapaniwala kay Andrew!

30. Les personnes qui ont une passion pour ce qu'elles font sont souvent plus motivées à y consacrer leur temps et leur énergie.

31. Walang nakakaalam kung saan sila napupunta.

32. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

33. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

34. Ang huni ng mga Kuliglig at kokak ng mga Palaka ay sumasaliw sa awit ng mga Maya.

35. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

36. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

37. Donald Trump is a prominent American businessman and politician.

38. Matumal ang bentahan ng bulaklak ngayong lockdown.

39. Nakatanggap kami ng masamang balita na ang aking kaibigan ay nawala at ito ay lubos naming ikinalulungkot.

40. Ako muna sabi, e, giit ni Ogor.

41. Paano ako pupunta sa airport?

42. My name's Eya. Nice to meet you.

43. At sa sobrang gulat di ko napansin.

44. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

45. Algunas personas se dedican a crear arte como su profesión.

46. Hanggang kailan mo ako girlfriend? diretsahang sabi ko.

47. Pumupunta siya sa Amerika taun-taon.

48. Hang in there."

49. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

50. Sa takot ay napabalikwas ang prinsesa at tinungo ang isang malapit na hukay.

Similar Words

career

Recent Searches

dreamipaliwanagbusiness,consistcarerisktenkaringroboticglobalbinigyangreducedprobablementemeetadverselytanimtodaycardsutilnanaypossibledividesviewsferrernaiinggitpinilingsinonglibrebelievedputahepracticadopinalakingkitangnangyariiniligtasprogramswindowvisualmemoryformsgeneratedemphasizedcornergapstatingfallrelativelynerissaginagawapanghihiyangilangkinagagalakbayadngawritealituntuninviolencenabagalanhighestgulangumuulanboholprosesosumindinakapagreklamokubyertossuccessfulbaoschoolcreationpaghahanguankikitaparinmagpahingamahiwagangmatipunotig-bebeintenabitawanmagpapaikotbakantekaalamandiseasespananglawtuvodistansyachamberstvsbarmayawitinalisfeedbackcovidhapdinamumulaklakmakapangyarihanglumalangoykinikitamedya-agwanagtutulunganhoypresleynagkapilatnakasandiguusapannagsisigawpagkuwanakakagalanagpalalimbloggers,marketplacesrevolucionadonagkakakainnaghilamosnanunurijingjingmasasayaactualidadnaiisipthanksgivingbalediktoryanpaghuhugaskanginaistasyonpangangatawanpakakatandaannaiyakpahiramnalugmokmagkamalikalalaropagkagustonagpakunotpinggapanalanginbasabatangnag-umpisapagtangishagdananrenacentistaeksempelbahaykisapmataapelyidokaratulangskirtkapitbahaynaglaonuniversitycompaniesbefolkningenisinalaysaynatatanawhiramroofstockpapalapitpinabulaanattorneypanginoontalinobighanigovernorsmataincomepupuntabarangayangelarabbamariellinagatolnatuloysagotrememberedisinamahanapinkulaypaskongjocelynhveriniintaypagputikasakitproudkuyanataposnakakulongmrsmaisisaacbilaobalancesnilulonsinampalresortmaaarisumagotscottishsinunod