Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "improve"

1. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

2. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

3. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

4. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

5. Eating a balanced diet can increase energy levels and improve mood.

6. Eating healthy is an important way to take care of your body and improve your quality of life.

7. Electric cars have a lower center of gravity, which can improve handling and stability.

8. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

9. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

10. In recent years, television technology has continued to evolve and improve

11. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

12. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

13. Limiting alcohol and caffeine intake can improve overall health.

14. Limiting the consumption of processed foods and added sugars can improve overall health.

15. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

16. Mathematics can be used to optimize processes and improve efficiency.

17. Owning a pet can provide companionship and improve mental health.

18. Protecting the environment can also improve public health by reducing exposure to harmful pollutants and chemicals.

19. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

20. Scientific research has shown that regular exercise can improve heart health.

21. Seek feedback, it will help you to improve your manuscript

22. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

23. The acquired assets will improve the company's financial performance.

24. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

25. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

26. They analyzed web traffic patterns to improve the site's user experience.

27. We need to optimize our website for mobile devices to improve user experience.

28. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

29. Working in a supportive and positive environment can improve job satisfaction.

Random Sentences

1. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

2. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

3. Seperti katak dalam tempurung.

4. Kailangan nating magkaroon ng lakas ng loob upang tuparin ang ating mga pangarap.

5. Nakangiting sagot ni Helena sa binata.

6. Las hojas de otoño son muy bonitas en la ciudad.

7. Joshua, kumusta ang pakiramdam mo?

8. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

9. Ang magnanakaw ay kumaripas ng takbo nang mabisto ng tindera.

10. Ang laki ng bahay nila Michael.

11. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

12. May bagong batas na ipinatupad ukol sa proteksyon ng mga manggagawa.

13. Les biologistes étudient la vie et les organismes vivants.

14. The teacher explains the lesson clearly.

15. A penny saved is a penny earned.

16. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

17. Sa anong tela yari ang pantalon?

18. Hihiramin ko sana ang iyong kopya ng libro para sa aking assignment.

19. Dahil malilimutin ang bata, iniwan niya ang kanyang takdang-aralin sa bahay.

20. Einstein's brain was preserved for scientific study after his death in 1955.

21. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

22. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

23. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

24. Ang pagdidilim ng aking paningin ay nagpahiwatig ng pagdating ng masamang panahon.

25. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

26. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

27. I am not teaching English today.

28. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

29. Sige na, sabihin mo na yung mga gusto mong sabihin sa akin.

30. Panahon na lang ang hahatol kung nararapat na ngang ibalik sa dating anyo si Kiko.

31. Nandito ako sa mall. Trip lang, ayoko pang umuwi eh.

32. Ano na nga ho ang pamagat ng palabas ninyo?

33. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

34. She missed several days of work due to pneumonia and needed to rest at home.

35. The king's family and heirs are often closely watched by the public and the media.

36. Nagtagisan ng galing ang mga maghahabi.

37. I know I should have apologized sooner, but better late than never, right?

38. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

39. El que espera, desespera.

40. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

41. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

42. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

43. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

44. Ako na ang bahala dito. aniya at akmang tatayo na.

45. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

46. Hugis katawan ng nakahigang babae ang bundok makiling.

47. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

48. Limitations can be physical, mental, emotional, financial, or social.

49. Hinawakan ko yung kamay niya.

50. Nasa labas ka ba? Teka puntahan kita dyan.

Similar Words

improvedimprovement

Recent Searches

improvehurtigerepagbatituktokmagsi-skiingmasdantungotinitindanakatulogrhythmtumiraipinadalainihandamateryalesobra-maestrahitwasaksinusuklalyankatawanpananakitmagkikitaibonstagepangyayaritransportationbinibiyayaanumigibinternanapapalibutanmakalingsumarapsigurofaultbituinrawlumamangscalenapilingactionlarrylumalangoysiksikanbagamatnicoparkelotbanlagvideos,sparemovieyelomurang-murabusytherapeuticsdemocracytaglagaspagkapasokkabiyaktsismosamagpapagupitdamitlunascuandonagbibigayannaghuhumindigbegangandakumustadetitinulosdontallowinguniquevaliosadiaperaksidentemukhananaypagbabagoparangsaidleeapatnapubiyernesnangpicschecksescuelasgumuhittaga-nayonnaiilangkusinadiincharismatickaliwaumangatnuclearkabibikasaysayannakakapuntafencingsumisilipbulsakinikitapasinghalcryptocurrency:eitheruugod-ugodpinakamahabanatingalarecibirimpactedmiranakikiabigparusahaninstrumentalusedsitawdinibunutannapakonangingilidnagbantaytiposdraft,graduallyitinuturoamparonerissakampopinatayminutepuntahanflyvemaskinerniyannaiinitannatabunannakatirangdadalawinmicanahigitanpresyodiscipliner,napatigilaga-agah-hoymatikmantumatawagmaongbentahanmapaparightsbroadcastsgustongnakayukoumabognagagamitinakalanag-aalanganmananakawmakikitulogmulighederpressrektanggulomahihiraptaxibobotowayumiinitbetapinag-usapanaguagumantitingnakatagonakatinginnakataastanawninongalecoaltutungodiallednagbababahehengacleararegladonanamansuelonagulatkumarimotlcdmakawalaconnectingentry:airportnaiwangtambayan