Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "educational"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

3. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

Random Sentences

1. Napakaganda ng bansang Pilipinas.

2. He gives his girlfriend flowers every month.

3. He has been practicing basketball for hours.

4. Ang kulambo at unan ay karaniwang ginagamit upang mapanatili ang kaginhawaan habang natutulog.

5. Ang galing nya magpaliwanag.

6. Mag-usap tayo sa WhatsApp o Line.

7. He likes to read books before bed.

8. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

10. Sa tuwing nakikita kita, nadarama ko na may gusto ako sa iyo.

11. Kung ako si Maico? Malamang magwawala ako. aniya.

12. Medarbejdere skal overholde sikkerhedsstandarder på arbejdspladsen.

13. Ipapainit ko ho ito sa kusinero namin.

14. At blive kvinde kræver også mod og selvstændighed.

15. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

16. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

17. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

18. Ang ibon ay mabilis na lumipad palayo matapos itong pakawalan mula sa hawla.

19. Ang kotseng nasira ay kotse ni Jack.

20. Wala akong pakelam, basta nasa ref ng bahay ko akin!

21. The United States also has a system of governors, who are elected to lead each individual state

22. She opted for a lightweight jacket to wear during her morning run.

23. Opo. Ano pong kulay ang gusto ninyo?

24. Si Teacher Jena ay napakaganda.

25. Maraming bayani ang naging simbolo ng pag-asa at inspirasyon sa panahon ng krisis at kahirapan ng bayan.

26. Los colores cálidos, como el rojo y el amarillo, transmiten energía en una pintura.

27. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

28. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

29. I absolutely agree with your point of view.

30. Okay na ako, pero masakit pa rin.

31. Mahusay gumawa ng bahay ang kanyang tatay.

32. They are not cooking together tonight.

33. Sa Pilipinas ako isinilang.

34. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

35. Mura lang ang mga damit sa Greenhills.

36. Mabait ang pamilya ni Aling Juana kaya panatag ang loob ng ama't ina ni Bereti.

37. Tumawag ang pamilya ng albularyo upang gumaling ang kanilang kamag-anak mula sa misteryosong sakit.

38. Tara Beauty. Mag-gala naman tayo ngayong araw. aniya.

39. She helps her mother in the kitchen.

40. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

41. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

42. The symptoms of pneumonia include cough, fever, and shortness of breath.

43. Sa kanyang lumang bahay, makikita mo ang kanyang koleksyon ng mga antique na kagamitan na hitik sa kasaysayan.

44. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

45. Baka matunaw ako. biglang sabi niya. Langya gising pala!

46. Hindi ko akalaing may nangahas na gumawa ng ganoong delikadong eksperimento.

47. Some people have a sweet tooth and prefer sweet flavors over others.

48. Maingay ang bagong taon sa Pilipinas.

49. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

50. It’s risky to eat raw seafood if it’s not prepared properly.

Recent Searches

bridepopulationdaddyrighteducationalhomeworkataplatodaangjamesgamesuelodontoutkumarimotcomelarryumiilingdevelopedrangeincludedoesgitarasettinginitsetscompletebetaexplainrelievedinternalearnaabotnagagalitipinamilisipadepartmentikinagalitguromagkaroonpalasulokfulfillinghalamanano-ordermatumalmagalangnangangahoynapakodiaperbobotomalamangpagdudugonakataaspulubivampiresnakalabasmakikitakasalukuyanpinagkiskisinvestbarangaynapalitangmartianarturonunrolandmaingaybanktungokapintasangpinauwikanilabutoundeniableentry:isasamasarisaringtoreteshowsconnectingbooksplagasnagpuntasadyang,gayunpamanpaanosemillassuotdaladalagraduallymediummessagepagguhitanubayanmalalimkahilinganyarisonidonaglabananlinawaffiliatemayamanlenguajeparurusahanginawanahigafarmkonsiyertoarbularyomaihaharapnakatirangnagkakasyanamulaklaknagpapakaintiniradornagtuturosalepaglalayagreserbasyonmagbibiyahemakikipag-duetosportssino-sinohealthierpinakamatapatnakaramdamdistansyamakalaglag-pantygratificante,controlarlassumpaaplicacionesexhaustionimporbumibitiwmagulayawnapagtantonasasabihaniintayinnabubuhayflyvemaskinernahihiyangpakakasalaniniuwiiniindalumutangnagtataenapahintodiyaryofranciscomagbalikmagbibiladpagsagotasignaturatangekskomedorgovernmentnalakipacienciaencuestasnakatindigfilipinatumatawagambisyosangpaghaharutandoble-karaumiwassuriinisinalaysaymakalingmaibade-latanabigkasrespektivemagalitikatlongumokayvictoriapagbibirovegasninyongpanatagpulgadasumasakaypaakyatobservation,tenidopauwiitinaasbasketballwakassandalitokyonapapikitphilippinekasalananwifiawitinnatitira