Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "guidance"

1. Fathers can be strong role models, providing guidance and support to their children.

2. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

3. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

4. The king's role is to represent his country and people, and to provide leadership and guidance.

5. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

Random Sentences

1. Bibili rin siya ng garbansos.

2. LeBron James is a dominant force in the NBA and has won multiple championships.

3. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

4. Me gusta preparar infusiones de hierbas para relajarme.

5. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

6. Tsong, hindi ako bingi, wag kang sumigaw.

7. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

8. Ang mga palaisipan ay maaaring nagbibigay ng mga oportunidad para sa paglutas ng mga problema at pagtugon sa mga hamon sa buhay.

9. Nagtitinginan na sa amin yung mga tao sa paligid namin.

10. Emphasis can help to ensure that a message is received and understood by the intended audience.

11. Der er mange forskellige rollemodeller og inspirationskilder for unge kvinder.

12. Kaya't tama lamang na ito rin ay kanyang ipapamana sa nag-iisang anak.

13. Sikat ang mga Pinoy vloggers dahil sa kanilang creativity at humor.

14. This could be physical products that you source and ship yourself, or digital products like e-books or courses

15. The relationship between work and mental health is complex and can vary from person to person.

16. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

17. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

18. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

19. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

20. Balak kong magluto ng kare-kare.

21. Mabuti na rin ang nakatapos ng pag-aaral upang pagdating ng panahon ay magagamit mo ito.

22. Hindi ka ba papasok? tanong niya.

23. Kasya kay Suzette ang blusang na ito.

24. Thanks you for your tiny spark

25. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

26. Opo. Magkapareho po ba ang disenyo?

27. Nangumbida ako ng maraming tao kasabay ng biling 'wag kalimutan ang regalo at pagbati ng �Happy Birthday,Rebo!�

28. Nagbabaga ang mga damdamin ng magkasintahan habang nag-aaway sila.

29. A father's love and affection can have a significant impact on a child's emotional development and well-being.

30. Ilalagay ko 'to sa mga action figure na collections ko.

31. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

32. Natigilan siya. Tila nag-iisip kung anong gagawin.

33. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

34. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

35. Gusto ko pumunta, pero pagod na ako.

36. Gaano kadalas kang nag-eehersisyo?

37. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

38. The website is currently down for maintenance, but it will be back up soon.

39. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

40. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

41. Nakakapagod pala umakyat ng bundok.

42. Les préparatifs du mariage sont en cours.

43. Let's not make this into a big deal - it's just a storm in a teacup.

44. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

45. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

46. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

47. Ang kotseng nasira ay kotse ni Jack.

48. Tumamis at sumarap ang lasa ng bunga.

49. Women have diverse perspectives and voices that can enrich society and inform public policy.

50. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

Recent Searches

matalimnayontulalaguidancepinoyperwisyotinikincidencenenanetflixsusiinfluencesnatulalabrasoangalsumisiddireksyonbikolbinatakanywhereplasaartistsmalamangkelangabrielpitumpongkapainmarmaingayonuuwihaykrussinkcinesumakaydiscoverednagdarasalhdtvnagulatpatistruggledhuwebestsakamaskitinitirhanubobinasaipantalophugismatayogelitefiadiamondpulubibusloupopropensoresignationtwitchbangiskoanituloysakimpootjokelaborkalanparalorireadersstaplebagoboboreloallowingbayantamadnakasandigtrainingtomhatingteleviseddoonbinabamichaelchecksgenerateipinaaidmakikipagbabagmallsvedsinceaddressochandopanguloginhawacompartenlorenadontdraybervotesechaveitlogthoughtsappactionmaratinganotherboxarmedbehindventanabuhaydawputingedit:dependingguideinsteadtutorialsclassmatebetaryanawarebackganitopoonyaripaki-ulitmallmanonoodnapakahangananghihinasagotngunitpayongiparatingthroatkumaliwauugud-ugodtiyakpagtitiponlarawanmagpagupitsundaedaraananubodre-reviewrabelayasbugtongsundalobiocombustiblesalwaysnamulaangelaginawangmagturocapacidadbatokpatiencekadaratingdistancenakakarinigmagsungitpointbinigaylungkotjagiyanagbungapaaralaninfusionesmakalabasumabogigigiithistoriatuwamulimaidtulogmagkakagustonabagalantubig-ulankaugnayansarapdispositivospalangitimabangongtongparaisokatamtamanresortsusunduinkinumutanpinagawamakaraannagkasakithimihiyaw