Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "guidance"

1. Fathers can be strong role models, providing guidance and support to their children.

2. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

3. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

4. The king's role is to represent his country and people, and to provide leadership and guidance.

5. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

Random Sentences

1. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

2. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

3. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

4. Kumaripas ng uwi si Pedro matapos niyang marinig ang masamang balita.

5. Sa mga nakalipas na taon, yumabong ang mga blog na mayroong malaking audience.

6. Ang masamang balita ay unti-unting naghatid ng kanyang damdamin palayo sa kasiyahan.

7. Matitigas at maliliit na buto.

8. Las plantas medicinales se utilizan para elaborar remedios naturales y tratamientos terapéuticos.

9. Anong hindi? Eh pulang-pula ka na oh!

10. Los padres pueden elegir tener un parto en casa o en un hospital, dependiendo de sus preferencias y necesidades.

11. Ang mga magsasaka ay nagtatanim ng palay.

12. Hindi niya agad napansin ang sugat hanggang sa sinubukan niyang salatin ito.

13. Gracias por creer en mí incluso cuando dudaba de mí mismo/a.

14. Einstein was a refugee from Nazi Germany and became a U.S. citizen in 1940.

15. Ayaw ng Datung paniwalaan ang mga aral na itinuturo sa Katolisismo.

16. Beauty is in the eye of the beholder.

17. Maraming taon na ang nakaraan, may isang munting baranggay sa paanan ng isang bundok.

18. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

19. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

20. The patient's family history of high blood pressure increased his risk of developing the condition.

21. Ang Sabado de Gloria ay tahimik

22. Get your act together

23.

24. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

25. Ang paggamit ng droga ay hindi lamang nanganganib sa iyong buhay, kundi pati na rin sa buhay ng mga mahal mo sa buhay.

26. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

27. El estudiante con el peinado raro está llamando la atención de sus compañeros.

28. Maiba ako Ikaw, saan ka magpa-Pasko?

29. The king's subjects are the people who live in his kingdom and are under his rule.

30. Les personnes qui ont une passion pour ce qu'elles font sont souvent plus motivées à y consacrer leur temps et leur énergie.

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Naulinigan ng makapangyarihang Ada himutok ng Buto.

33. Kevin Durant is a prolific scorer and has won multiple scoring titles.

34. Ang ganda ng bagong laptop ni Maria.

35. The acquired assets were carefully selected to meet the company's strategic goals.

36. At hindi papayag ang pusong ito.

37. Mabini ang sumulat ng konstitusyon ng unang Republika ng Pilipinas.

38. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

39. Dapat nating igalang ang kalayaan ng bawat isa kahit na mayroong magkaibang paniniwala.

40. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

41. Some people have a sweet tooth and prefer sweet flavors over others.

42. Maraming mga bata ang mahilig sa pagguhit dahil ito ay isang paraan upang magpakita ng kanilang imahinasyon.

43. Have you tried the new coffee shop?

44. Está claro que la evidencia respalda esta afirmación.

45. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

46. Dala ito marahil ng sumpa sa iyo ni Matesa.

47. El realismo y el impresionismo son estilos populares en la pintura.

48. Tila hindi pa tapos ang laban, kaya’t kailangan pa nating maghanda.

49. Ang siko ng bata at tumama sa kanyang kaliwang dibdib.

50. Der er en række organisationer og programmer, der tilbyder hjælp til mennesker, der kæmper med gamblingafhængighed.

Recent Searches

napapatinginguidanceforskelkamoteangkopakongmarilouexperts,sinimulannapatinginriyanyourself,roselleairconstruggledbuntiswidelyaksidentelihimdeletingpinagbinibiliamericanadangimportanttradedyipkasingtigascomputere,mukakagandaparangzoosupilinhopetarcilachoiwashingtoncuredunderholderwordsstaplekatabingkwebangmenosbairdcupidiguhitpaskobarrocolapitanbutihinginaadvancedconventionalbranchessumalaellamaminathandogsamumarsobluemulideasayudaeksamflybringingibabapartetoplatformstuwidmainitinformationtransitgracemeanballsequeaddinggitanasmapstarteddifferentcontrolaestablishedcablegenerationsmikaelaformslaverawipongnapasigawtitanapanoodumiiyaklumabaspagkaraamakabilisuriinrodonamaglarouwakpaliparinkirbysabonggusalipesotakotnaalissadyangbumalingfreedomsganidpagkatpangalannararapateneromisacapitalmaingatyeyatafriestransparentbiggestdatahellolabananfacilitatingnaantighanapbuhayasukaltinikmanincitamenterunconventionalunospinisilninyongandreaeconomicbaku-bakongbayaningbankexperience,nababalotmaramotyamannatitiracompletamentenyansayawantondowaterautomationkatagalandisyembrelinawkinantadiyossedentarybumababalivespagsumamonakapagreklamonaglulusakmalimittandangdespuesngipingbuenasacrificepresyoseniorpaawalongsoccertrenparocivilizationplacepopcornpoorerso-calledgisingdontfertilizersinabio-onlineseeneasierjeromemasayahinmahuhulitanghalimaintindihan