Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "internet"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ang bagal ng internet sa India.

3. Ang bilis ng internet sa Singapore!

4. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

5. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

6. El internet es una fuente de entretenimiento, como videos, juegos y música.

7. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

8. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

9. El internet ha hecho posible el trabajo remoto y la educación a distancia.

10. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

11. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

12. Hoy en día, el internet es una parte integral de la vida cotidiana.

13. Huwag masyado magpaniwala sa mga nababasa sa internet.

14. It was founded in 2012 by Rocket Internet.

15. Kailangan ko ng Internet connection.

16. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

17. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

18. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

19. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

20. Laganap ang fake news sa internet.

21. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

22. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

23. Mabuti naman at bumalik na ang internet!

24. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

25. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

26. Napakabagal ng internet sa aming lugar.

27. Nawalan kami ng internet kaninang madaling araw.

28. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

29. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

30. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

31. The internet is full of fashion blogs. They're a dime a dozen.

32. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

33. The invention of the telephone and the internet has revolutionized the way people communicate with each other

34. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

35. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

36. Wala na naman kami internet!

Random Sentences

1. He is not typing on his computer currently.

2. I've been using this new software, and so far so good.

3. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

4. The team captain is admired by his teammates for his motivational skills.

5. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

6. Mas mabuti pang magpakatotoo at huwag maging masyadong kababaw sa mga bagay.

7. Limitations are the boundaries or constraints that restrict what one can or cannot do.

8. Huwag masyado magpaniwala sa mga nababasa sa internet.

9. Naabutan niya ito sa bayan.

10. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

11. Huwag na sana siyang bumalik.

12. En la realidad, las cosas no son siempre en blanco y negro.

13. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

14. Napaluhod siya sa madulas na semento.

15. High blood pressure can often be managed with a combination of medication and lifestyle changes.

16. Mas malaki ang silid-aralan ngayon kumpara sa dati dahil sa pagdami ng mga estudyante sa paaralan.

17. She reads books in her free time.

18. Ang puso niya’y nagbabaga ng pagmamahal para sa kanyang pamilya.

19. Natutuwa siya sa husay ng kanyang naisip.

20. Pakibigay sa driver ang bayad ko sa pamasahe, wala akong abot.

21. Natigilan siya. Tila nag-iisip kung anong gagawin.

22. May I know your name so we can start off on the right foot?

23. Fra telefoner til computere til tv'er, elektronik har revolutioneret måden, vi kommunikerer og får adgang til information

24. I just launched my new website, and I'm excited to see how it performs.

25. Mahina ang kita ng kanyang ina sa paglalabada; mahina rin ang kanyang kita sa pag-aagwador.

26. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

27. Malalaki ang ahas na nakakulong sa zoo.

28. Su estilo artístico se caracterizaba por la tensión emocional y la expresión dramática.

29. Today, Presley is widely considered to be one of the most important figures in American music and culture

30. Ang bukas palad na pagbibigay ay hindi palaging tungkol sa pera, pwede rin naman itong mga bagay na hindi nakakalat.

31. A lot of people volunteer their time and resources to help those in need.

32. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

33. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

34. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

35. Ang nagdudumaling helicopter ay masigla na naglilipad sa himpapawid.

36. Walang password ang wifi ng kapit-bahay.

37. Mahirap magsalita nang diretsahan, pero sana pwede ba kitang mahalin?

38. Athena. nagulat siya at bigla niyang pinatay yung monitor.

39. Natutuwa ako sa balitang iyan mahal ko.

40. Sunud-sunod na nakatalungko ang mga ito sa isa pang bangkong nas atagiliran ng nanggigimalmal na mesang kainan.

41. Nasa kuwarto po siya. Sino po sila?

42. Después de la lluvia, el sol sale y el cielo se ve más claro.

43. Waring hindi pa handa ang kanyang puso na magmahal muli.

44. Si Maria ay nag-aapuhap ng tulong sa kanyang mga kaibigan para sa isang charitable event.

45. Nagustuhan kita nang sobra, kaya sana pwede ba kita makilala?

46. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

47.

48. El cilantro es una hierba muy aromática que se utiliza en platos de la cocina mexicana.

49. All these years, I have been grateful for the opportunities that have come my way.

50. Pinabulaanang muli ito ni Paniki.

Recent Searches

internettuwidiosfataldennuclearstudentpalayanexamplekapilingdifferenterrors,sameofteneditedit:mulingsupportgapdiseasesbunutanmunanakikilalangnagpapaigiblamang-lupamakitapneumonialupalopipinagdiriwangkaragatanpanalanginbintanawakasbihirarisegabrielgawingawingnapakabaitgodreadcomputere,iatflangprogrammingpagkahaporosarioinaabutanlabisnandayamagbalikartistsyearsmarurumibinabaratdalawangpagbabayadangkophanginnitongkalaunancarolstaplefeltsumabogkuboturonsurveysbefolkningensampungpayongkakayanancurtainsandamingreynasurroundingsilagayschoolanumannatitirakakayanangmaubosmatikmannaiwangbugtongmarchdeathschoolshydelbilhinbinigyangrestawanmaitimmapa,sirdistansyanagsusulatgayunmannakapapasongnagmungkahimanlalakbaymagpa-ospitalbutihingnakasuotresignationjoeibigramdamahitweddingdalawanamumukod-tangimakalaglag-pantypinagmamalakipinagkaloobannakakapagpatibaykumukuhapamilyangpumuslitjobsnakalagaynakasandignakayukomakatarungangh-hoypagngitibangladeshnariyannapanapakopanggatongbuongnaglahogumawatagaytaypilipinaspinag-aralanmagkamaligandahanyoutube,nagkasakitamericapaghalikmakauwihawaiimaibibigayrektanggulojuegosnakahugsugatangginagawapinansinnationalvedvarendenahigitantinuturoevolucionadoparkehabitssakalingsukatinnawalasumalakaynakauslingnabasalever,mayroongambagsapatdasallayawracialestilosiyakejecutannag-replysaramulighederlipaddikyamdisposalmagigitinglistahanhomepumulottransmitidasgoodeveningcelularesintereststwo-partydinanashaypasalamatanumaagoslonghalikamapapaproblemaconectanmalapit