Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "internet"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ang bagal ng internet sa India.

3. Ang bilis ng internet sa Singapore!

4. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

5. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

6. El internet es una fuente de entretenimiento, como videos, juegos y música.

7. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

8. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

9. El internet ha hecho posible el trabajo remoto y la educación a distancia.

10. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

11. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

12. Hoy en día, el internet es una parte integral de la vida cotidiana.

13. Huwag masyado magpaniwala sa mga nababasa sa internet.

14. It was founded in 2012 by Rocket Internet.

15. Kailangan ko ng Internet connection.

16. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

17. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

18. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

19. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

20. Laganap ang fake news sa internet.

21. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

22. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

23. Mabuti naman at bumalik na ang internet!

24. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

25. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

26. Napakabagal ng internet sa aming lugar.

27. Nawalan kami ng internet kaninang madaling araw.

28. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

29. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

30. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

31. The internet is full of fashion blogs. They're a dime a dozen.

32. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

33. The invention of the telephone and the internet has revolutionized the way people communicate with each other

34. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

35. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

36. Wala na naman kami internet!

Random Sentences

1. Mabilis ang takbo ng pelikula.

2. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

3. Gusto ng ina na matuto si Pinang ng mga gawaing bahay, ngunit laging ikinakatwiran ni Pinang na alam na niyang gawin ang mga itinuturo ng ina.

4. Berbagai lembaga dan organisasi keagamaan berperan aktif dalam memberikan pelayanan sosial, pendidikan, dan bantuan kemanusiaan bagi masyarakat Indonesia.

5. "Dogs leave paw prints on your heart."

6. Nakakatakot ang kanilang lugar sapagkat andaming adik.

7. "Bawal magtapon ng basura rito," ani ng bantay sa parke.

8. Dalam beberapa kasus, orang tua bayi dapat meminta bantuan dukun bayi untuk merawat anak mereka.

9. Indonesia dikenal dengan pantai-pantainya yang indah dan airnya yang jernih, seperti Bali, Lombok, dan Gili Islands.

10. Napadungaw siya sa kanyang cellphone at napansin na mayroon siyang mga hindi pa nabasang mensahe.

11. Ako si Rodona ang diwata ng budok na ito.

12. Bagamat sa Limasawa, Leyte nagdaos ng unang misa, may isang paring Kastilang nagngangalang Padre Novelles ang nakarating sa lalawigan ng Nueva Ecija.

13. Ano ang gagawin mo sa Linggo?

14. Nagdiriwang sila ng araw ng kalayaan.

15. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

16. Bumili ako ng bagong set ng kubyertos para sa aming bahay.

17. A couple of candles lit up the room and created a cozy atmosphere.

18. The platform has implemented features to combat cyberbullying and promote a positive online environment.

19. Ang paggamit ng droga ay maaaring magdulot ng pagkakaroon ng mga karamdaman, tulad ng mga sakit sa puso, kanser, at mga problema sa paghinga.

20. The United States has a system of government based on the principles of democracy and constitutionalism.

21. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

22. It can be helpful to get feedback from beta readers or a professional editor

23. If you want to get the best deals at the farmer's market, you have to be the early bird.

24. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

25. Para sa kaniya, mas masarap magbasa kapag nag-iisa.

26. Kailangan ng mas magandang oportunidad sa trabaho at edukasyon para sa sektor ng anak-pawis.

27. Puwede ho ba akong pumasok sa klase?

28. Le tabagisme est un facteur de risque majeur pour de nombreuses maladies, notamment les maladies cardiaques et le cancer.

29. Nagbakasyon si Clara sa Hawaii.

30. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

31. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

32.

33. Naramdaman kong nag vibrate yung phone ko.

34. Børn bør have tid og plads til at lege og have det sjovt.

35. Inilabas ng guro ang kanyang laptop sa silid-aralan upang ipakita ang kanyang mga presentasyon.

36. The United States has a system of federalism, where power is divided between the national government and the individual states

37. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

38. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

39. Bagaimanakah kabarmu hari ini? (How are you today?)

40. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

41. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

42. Mabilis na lumipad ang paniki palabas ng kweba.

43. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

44. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

45. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

46. Kumain ako sa kapeterya kaninang tanghali.

47. No pain, no gain

48. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

49. Nahihirapan ka na siguro.. sorry.

50. This house is for sale.

Recent Searches

howeveralininternetkarnabalroletruesidoprogrammingdoesknowledgewhileedit:ableevolvedinteligenteslargehulingtechnologiesannacorneriniisipthankyonlayuninrailwaysbodegaawitanvariousregularmentegodtbulapagkaimpaktoitinalagangumilingnahulaandisappointnaawastylespakibigyanmaestra2001magbigayannagisingkulangnanaykasalnaalistigaswalkie-talkienagtutulungannag-eehersisyopagpapakilalapagkakayakapnalulungkotnakagalawnanghihinamadnagliliwanagkakuwentuhanmagpapagupitkabuntisanparangnamumulotdumagundonginsektongpagkuwamahalinmaihaharappamamasyalkwenta-kwentat-shirtpagkakamaligayunmanmusicianlumamangkumalmamagalangnakapasatinakasanpagtawafitnessdatunapasubsobintindihinabundantetv-showsumakbaymahinamaipapautangmayamayanakablueiniuwigiyeramagamottemperaturaipinatawagmanilbihannalangpasasalamattelecomunicacionestagpiangbasketbolkumanangawainkotsenagbabaganagpaalamkontrarimaskababalaghangtakottsinamangingisdangabrilpasahesakoproofstockcurtainslugawunosnatakotmaaksidentekahirapanrieganakakamitkalahatingelectionsbukasofficeewanlangkaykenjiipinanganakpagdamiminamasdanpinoytengalangostabasurapagka-datutshirtexhaustedkagandapumatoltagalogsumasakitmeronpalapitbotobiglagoodeveningscottishkrusiiklisinapakhangaringbairdsubalitmakisigmahahabasparesumakitfireworksspecialsumamachavitbinibinihigitexcitedinstrumentaltabasactingconsideredinalokcomplicatednagreplyintroducetaledarkbakeartificialpracticadohelpfullastingsensiblestringeditorawarereleasedpackaginganimbowpotentialyunreceptorkamakalawatuyoibinalitangmakalawanakapapasongbilhin