Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "internet"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ang bagal ng internet sa India.

3. Ang bilis ng internet sa Singapore!

4. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

5. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

6. El internet es una fuente de entretenimiento, como videos, juegos y música.

7. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

8. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

9. El internet ha hecho posible el trabajo remoto y la educación a distancia.

10. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

11. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

12. Hoy en día, el internet es una parte integral de la vida cotidiana.

13. Huwag masyado magpaniwala sa mga nababasa sa internet.

14. It was founded in 2012 by Rocket Internet.

15. Kailangan ko ng Internet connection.

16. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

17. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

18. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

19. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

20. Laganap ang fake news sa internet.

21. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

22. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

23. Mabuti naman at bumalik na ang internet!

24. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

25. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

26. Napakabagal ng internet sa aming lugar.

27. Nawalan kami ng internet kaninang madaling araw.

28. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

29. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

30. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

31. The internet is full of fashion blogs. They're a dime a dozen.

32. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

33. The invention of the telephone and the internet has revolutionized the way people communicate with each other

34. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

35. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

36. Wala na naman kami internet!

Random Sentences

1. May sinasabi ka ba? umiling ako sa tanong ni Kenji

2. Sa gitna ng krisis, marami ang nagkakaroon ng agam-agam sa kanilang kinabukasan.

3. Ang laman ay malasutla at matamis.

4. It's raining cats and dogs

5. Mathematics is the study of numbers, quantities, and shapes.

6. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

7. She does not use her phone while driving.

8. Mayroon akong asawa at dalawang anak.

9. Wag kana magselos, mahal naman kita eh.

10. Gusto niyang lumayo at maglakbay palayo sa lugar ng kanyang kabataan.

11. Nalungkot ang Buto nang dumilim na ang paligid.

12. Sa isang forum ng mga mamimili, ibinahagi nila ang kanilang mga mungkahi upang mapabuti ang kalidad ng mga produkto.

13. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

14. Eh ayoko nga eh, sundae lang talaga gusto ko.

15. Mainit sa Pilipinas sa buwan ng Abril.

16. Umingit ang sahig ng kanilang barungbarong nang siya'y pumasok.

17. Sa bawat tula ng makata, maririnig ang malalim na hinagpis ng kanyang puso.

18. Ano ang ginawa ni Tess noong Abril?

19. He has bigger fish to fry

20. Nakapagtataka na may ilang tao na hindi pa nakatikim ng pulotgata.

21. Nilinis ng janitor ang silid-aralan bago mag-umpisa ang klase.

22. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

23. Ano ang inireseta ng doktor mo sa iyo?

24. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

25. Viruses are small, infectious agents that can infect cells and cause diseases.

26. Maaf, saya tidak mengerti. - Sorry, I don't understand.

27. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

28. Eksport af forskning og udvikling er en vigtig del af den danske økonomi.

29. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

30. Ang pangalan niya ay Mang Sanas.

31. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

32. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

33. A mi esposa le encanta hacer manualidades como pasatiempo.

34. Kumain ka na ba? Tara samahan kitang kumain.

35. Pinahiram ko ang aking golf club sa aking kaopisina para sa kanilang tournament.

36. Pakibigay sa akin ang iyong opinyon tungkol sa balitang nabasa mo.

37. La creatividad puede ayudar a solucionar problemas de manera más efectiva.

38. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

39. She is not cooking dinner tonight.

40. Traveling to a conflict zone is considered very risky.

41. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

42. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

43. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

44. Las labradoras son perros muy fuertes y pueden soportar mucho esfuerzo físico.

45. Mon mari et moi sommes mariés depuis 10 ans.

46. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

47. Ang bilis ng internet sa Singapore!

48. Twinkle, twinkle, little star,

49. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

50. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

Recent Searches

internetreportvismapadaliaddcomunessulingandaddypagdidilimlibagumarawechavecornerdeclareeventalecrazybitawanbeginningstudiedpinilingtuparinkandoysaraduloedit:mulingmasterinterviewingroughsetspinipisillearnwhichtechnologieswebsitede-latajohncontinuedworkshopmuyitemsclockkinagigiliwangguidepublishedilingcontrolakamingnanghahapdikakuwentuhanpagngitimaglakadmentaltaga-ochandobugbuginmerlindaanibersaryosaranggolamarketplacesnakagalawpoliticalfionakinalalagyanmagbibiladkidkiranlalakadnangangalitpangangatawantuhodfilipinakalalarouusapankikilosnahuhumalingpagtatanongpinahalatakaymagkaparehonapapalibutanriyantiyakannagkapilatnamumulothighestmakapalmagkasinggandaskirtculturasipinatawagpalayaniniinda300sistemasipinabalotnakakaanimnamuhaynagpapantalniyonprincipalesmaasahanhouseholdhulihannalugoddinipang-isahangminatamisnanangiskakilalagiverpumulotmakaiponsinisiranilaossalonnanamankaratulangtherapeuticsamuyinlumindolutak-biyangitinakaakyatnakahugpaghabaasukalawitanrespektivepasasalamathinandenlabisbusiness:pinabulaannakakaakitpresentsapatosplatformsdulibankpagtataposherramientasnakainnagsimulamatutongharap-harapangroofstocktatlongdalawangmanonoodtmicasunhingalpebrerowikaamendmentsjuliusinintaypagkaingtandangpatientprobinsyapollutionlegislationmostmagbumotonag-replymaidhikingdeletingrevisepasyanapabalikwasbituinmabilisborgerecornersnatiralordarghnag-uumiriitongbecomesinapakkantointeragereripagbilipakelamstillbernardobinibinibinigaydetteirognasulyapankakutisburdenhumanoskaringmuchas