Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "internet"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ang bagal ng internet sa India.

3. Ang bilis ng internet sa Singapore!

4. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

5. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

6. El internet es una fuente de entretenimiento, como videos, juegos y música.

7. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

8. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

9. El internet ha hecho posible el trabajo remoto y la educación a distancia.

10. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

11. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

12. Hoy en día, el internet es una parte integral de la vida cotidiana.

13. Huwag masyado magpaniwala sa mga nababasa sa internet.

14. It was founded in 2012 by Rocket Internet.

15. Kailangan ko ng Internet connection.

16. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

17. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

18. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

19. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

20. Laganap ang fake news sa internet.

21. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

22. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

23. Mabuti naman at bumalik na ang internet!

24. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

25. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

26. Napakabagal ng internet sa aming lugar.

27. Nawalan kami ng internet kaninang madaling araw.

28. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

29. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

30. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

31. The internet is full of fashion blogs. They're a dime a dozen.

32. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

33. The invention of the telephone and the internet has revolutionized the way people communicate with each other

34. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

35. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

36. Wala na naman kami internet!

Random Sentences

1. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

2. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

3. Gusto ko na magpagupit ng buhok.

4. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

5. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

6. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

7. Kilala si Hidilyn Diaz sa kanyang malakas na paninindigan para sa mga kababaihan at atletang Pilipino.

8. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

9. La tecnología ha permitido la creación de nueva música y la producción de grabaciones de alta calidad.

10. Nosotros disfrutamos de comidas tradicionales como el pavo en Acción de Gracias durante las vacaciones.

11. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

12. Ang hinagpis ng buong bansa ay naging lakas upang magkaisa sa harap ng pagsubok.

13. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

14. Sumimangot ako at humarap ulit sa labas.

15. Muchas ciudades tienen festivales de música que atraen a personas de todo el mundo.

16. Madalas banggitin si Carlos Yulo sa mga balita tuwing may malaking kompetisyon.

17. Iniuwi ni Rabona ang pusang iyon.

18. Ang bayanihan ay isang tradisyonal na gawain kung saan ang mga taga-komunidad ay nagtutulungan para sa isang layunin.

19. Knowledge is power.

20. Pull yourself together and focus on the task at hand.

21. El flamenco es un género musical y de danza tradicional de Andalucía, con raíces gitanas, que se caracteriza por su intensidad emocional y su riqueza rítmica

22. The value of cryptocurrency can fluctuate rapidly due to market forces.

23. Ang mga bayani ay nagpapakita ng disiplina at determinasyon sa paglutas ng mga problema ng bayan.

24. El estudiante con el peinado raro está llamando la atención de sus compañeros.

25. Congress are elected every two years in a process known as a midterm election

26. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

27. Ang mga bayani ay nagbibigay ng pag-asa at magandang kinabukasan para sa mga susunod na henerasyon ng mga Pilipino.

28. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

29. High blood pressure can be managed effectively with proper medical care and self-care measures.

30. Algunas heridas pueden requerir de cirugía para su reparación, como en el caso de heridas graves en órganos internos.

31. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

32. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

33. Tengo escalofríos. (I have chills.)

34. Mukha namang pangkaraniwan lang ang matanda at baka nga hindi pa nito alam kung paano humabi.

35. Scissors can have straight blades or curved blades, depending on the intended use.

36. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

37. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

38. Kung kulang ka sa calcium, uminom ka ng gatas.

39. Nanalo siya ng Palanca Award para sa panitikan

40. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

41. Pagkababa, mabilis na siyang nagyayang umuwi.

42. Kumusta ho ang pangangatawan niya?

43. Nagluto ng pansit ang nanay niya.

44. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

45. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

46. He admired her for her intelligence and quick wit.

47. Nagsimula ang programa sa dakong huli ng gabi.

48. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

49. Iilan pang taon ang nakalilipas sa kanyang pagka-Datu nang siya ay nagkaroon sa kanyang kabiyak ng isang tagapagmana ng kaharian.

50. Ang pagkakaroon ng tamang kaalaman at kakayahan ay makakatulong upang maibsan ang pangamba.

Recent Searches

evolvedinternetnagtitindanakahigangrenombrehinawakanaktibistanakaririmarimsinapokpasyalanmagtataaskanikanilangunattendedkasintahanadgangtungkodpinisilisinuotemocionesbibilihospitalsupportbayaningnilayuanisuboreynaengland1960smonumentogreatlymaisipbuhoksalesmarangyangsilyaheartbreakcareernitoleadinginangbinasanagsipadyiptrademakasilongnakasahodseryosongdoktormenosarbejderprimerbroadcastumingitnuonsumusunomaymahabangrecordedkalikasanbasahanrhythmpumuntaipasokarawkartonthreetutorialskasinggandainspirasyonkwenta-kwentapaglalayagreserbasyonmagbibiyahemagasawangnanghihinanakapapasonghealthierressourcernemalezamarketplacesmaipantawid-gutomnapakamisteryosogalingpagpapatubopagka-maktolikinakagalitmovieskinamumuhianpalipat-lipatpinagsikapannaabutankabuntisanpupuntahanpahahanapmakapalaginilalabasluluwasmagbayadmakahiramnagtungomagkaibat-shirtpapanhikkumakantapagkabiglanaapektuhanibinilimasaksihanmahinangairportmatagpuangandahannakabawipagpanhiknapipilitanulapvidenskabpagbigyannagdaboggawinlaruinpinigilannagdadasalthanksgivingvideobalediktoryanengkantadanglumibotnakasakitsasakyancover,orkidyastagpiangnagbagogumigisingkangitannagsilapitpagguhitpundidokumampipaparusahannakatuonnakabluenahantadnatakotpinaulanangusalisaktancynthiatalagangmagalithinamaknilaospatakbongsugatangnanamande-latasakopmalasutlaretirarantesasahanmassachusettsairplanesdumilathanapinlivesbiyasnasankarapatanbutosikiptiyancocktailbumangonlayuanturonrobinhoodnatayomaglabapangako3hrsinakyatkayatokyobuntissalitangbinibilangbilanginotherslalongaaisshnakatitiyakoperahanlarokagandahomeschoimayabang