Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "senate"

1. Congress is divided into two chambers: the Senate and the House of Representatives

2. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

Random Sentences

1. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

2. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

3. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

4. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

5. Bawal magdadala ng baril sa loob ng paaralan dahil ito ay delikado sa kaligtasan ng mga estudyante.

6. Einstein was married twice and had three children.

7. International cooperation is necessary for addressing global environmental challenges, such as climate change.

8. How I wonder what you are.

9. Natapos ko ang aking trabaho sa opisina sa hatinggabi dahil marami akong backlog.

10. Leukemia is a type of cancer that affects the blood and bone marrow.

11. Walang anuman saad ng mayor.

12. Sa aling bahagi ng pelikula ka natawa?

13. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

14. The festival showcases a variety of performers, from musicians to dancers.

15. Les soins palliatifs et la fin de vie sont des aspects importants des soins de santé.

16. Nakapasa si Andrew sa pagsusulit.

17. Batman, a skilled detective and martial artist, fights crime in Gotham City.

18. Tinutukoy niya ang tarangkahan ng opisina kung saan sila magkikita.

19. Mabuti na lamang at nandyan ang kanyang kaibigan.

20. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

21. Marami rin silang mga alagang hayop.

22. Mahirap hanapin ang kasagutan sa kaibuturan ng suliranin.

23. May meeting daw ang lahat ng guro kaya't kami ay maagang pinauwi.

24. Payat at matangkad si Maria.

25. Malulungkot siya paginiwan niya ko.

26. Work-life balance is important for maintaining overall health and wellbeing.

27. Erfaring har lært mig at tage ansvar og være proaktiv.

28. May kakaibang naramdaman ang prinsesa sa makisig na binata na iyon.

29. Después de una semana de trabajo, estoy deseando que llegue el fin de semana.

30. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

31. AI algorithms are computer programs designed to simulate intelligent behavior.

32. Paki-bukas ang bintana kasi mainit.

33. Ipaghugas mo siya ng mga Maghugas ka ng mga

34. Lazada is an e-commerce platform that operates in Southeast Asia.

35. Nakatitig siya sa tatlo pa niyang kapatid.

36. Nakaka-bwisit talaga ang nangyari kanina.

37. Ngunit walang maibigay ang mga tao sapagkat salat din sila sa pagkain.

38. Cada año, la cosecha de manzanas en esta región es muy buena.

39. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

40. Ang saranggola ay simbolo ng kasiyahan noong kabataan.

41. At kombinere forskellige former for motion kan hjælpe med at opnå en alsidig træning og forbedre sundheden på forskellige måder.

42. Drømme kan være en kilde til inspiration og kreativitet.

43. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

44. Hindi malinis ang mga tsinelas ni Lori.

45. The pretty lady at the store helped me find the product I was looking for.

46. Ang rebolusyon ang tumapos sa pananakop ng mga kastila.

47. Gaano ka kadalas nag-eehersisyo?

48. Sa pagpapakumbaba, maraming kaalaman ang natututunan.

49. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

50. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

Recent Searches

senatengunitkinalilibinganperfectipinanganakpulisnagkalapitwasteiilangonghatinggabisirkagalakannakatagonogensindetanggalinpagkakamalichoosebosesanitosumakaykangkongnagmamadalienterumokaywordskambingnabiglaflyvemaskinernamilipitnakalilipasorderinpangetbihirangproducekaninomakipagtagisansumagotistasyonbillganaatetelaflytaga-tungawcoachingcolourmakaiponsakinpatuloyconstantjuegoskakayananmataraycarlobranchesmag-aaralipipilitulocommunicaterawsayamatatandamatangumpaymaghintaykumaenmagkanonag-aabangnakapapasongknow-howano-anoseryosongmalawakyumao1940leytelagunatelangaudio-visuallysalu-salotenidoninadinanasnuevoawtoritadongtelevisionpshcongresstelebisyonrenacentistaarteparaisonabigaypumansinyumabangnatulalaumagangconvertidasipagbilimagsalitamataoffentligekatapatkakaantaykanserinintayknownnakakasamanagtalagauniversitiesctricassinekalakihanpagsisisiqualitybituintracklumusoberrors,ginagawamegetnangyarileftmesayanglagiabalapossibletinderatraveladditionally,neverfederalwhetherlumitawpinoyelectionsdekorasyonconstitutionkomedorlagaslaskahusayansulatlamesatanyagsumigawnaglahopaydressfieldprincipaleslabisgrabereaksiyonnararapatpinagpatuloyairconagaw-buhayyumuyukotheypapasaexperience,carriedmaaringamazonprogresspasyentelasinghardinsapatosbobonagdasalambaganayimpactedtiningnanfastfoodnamumuongalapaapsasapakinmaibigaysasakyanikinatatakotmagkakaanaksundaenawalainterviewingjoeipinadalapalaginakabluelumabasinaabutanplanning,tingmalayaikinagagalaklotdyosaipinasyang