Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "overall"

1. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

2. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

3. Limitations can impact one's career, relationships, and overall quality of life.

4. Limiting alcohol and caffeine intake can improve overall health.

5. Limiting the consumption of processed foods and added sugars can improve overall health.

6. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

7. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

8. Overall, television has had a significant impact on society

9. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

10. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

11. Work-life balance is important for maintaining overall health and wellbeing.

Random Sentences

1. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

2. Ang mga bulaklak sa mesa ay nagbigay ng mabangong ambiance sa hapag-kainan.

3. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

4. I got my sister a cake and wrote "happy birthday" in frosting on top.

5. The hospital had a special isolation ward for patients with pneumonia.

6. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

7. Helte kan være en kilde til inspiration og motivation.

8. Ano ang gustong bilhin ni Juan?

9. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

10. Durante las vacaciones, me gusta relajarme en la playa.

11. Cryptocurrency wallets are used to store and manage digital assets.

12. Larry Bird was a versatile forward and one of the best shooters in NBA history.

13. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

14. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkaligaw sa landas ng katwiran.

15. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

16. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

17. Magandang araw, sana pwede ba kita makilala?

18. Pumulot siya ng mga bao ng niyog, gamit na panggatong sa apoy, at hinagis sa lola.

19. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

20. The music playlist features a variety of genres, from pop to rock.

21. Ang magnanakaw ay mahigpit na inabangan ng mga pulis matapos ang operasyon.

22. Sa lahat ng paborito niyang prutas, ang saging ang may mababa na asukal.

23. The blades of scissors are typically made of stainless steel or other durable materials.

24. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

25. Les examens et les tests sont des évaluations importantes pour les étudiants.

26. Cryptocurrency can be used for both legal and illegal transactions.

27. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

28. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

29. El color y la textura son elementos fundamentales en la pintura.

30. Uh huh? medyo naguguluhan kong sabi.

31. Ang daming limatik sa bundok na kanilang inakyat.

32. Sayang, tolong maafkan aku jika aku pernah salah. (Darling, please forgive me if I ever did wrong.)

33. Ang pagsalungat sa agaw-buhay na sistema ng lipunan ay kailangan upang magkaroon ng tunay na pagbabago.

34. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

35. Sa Taal, Batangas matatagpuan ang Mabini Ancestral House na pinaniniwalaang bahay-bata ni Apolinario Mabini.

36. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

37. Tinamaan ng lumilipad na bola ang bintana at ito’y nabasag.

38. Ako si Rodona ang diwata ng budok na ito.

39. Nagbago ang anyo ng bata.

40. Dapat bigyan ng karampatang atensyon ang mga isyu ng sektor ng anak-pawis.

41. Mahalaga rin ang pagkakaroon ng malawak na kaalaman at kakayahan sa pagpapasya upang malutas ang mga palaisipan sa buhay.

42. Nakatingala siya kay Ogor, mahigpit na kinukuyom ang mga palad.

43. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

44. He forgot his wallet at home and therefore couldn't buy lunch.

45. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

46. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

47. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

48. I am absolutely committed to making a positive change in my life.

49. The city installed new lights to better manage pedestrian traffic at busy intersections.

50. My boss accused me of cutting corners on the project to finish it faster.

Recent Searches

overalldalandanhitikestarcasabeginningsdisensyomatagal-tagalmagkaibakinagalitannamulaklaknagtungovirksomhedermagsugalpinigilanmagandangsabihinmagpagupitre-reviewpinalayasscottishkasoysiyangpumapaligidkinikilalangnalalabimahawaannagandahanintramuroskuripotnakahainaga-agaelectronicmanirahanitinatapatbabasahinpagkainisnag-aagawanbayawaknabubuhaypag-iwanpookroonkindergartenpagpalitcynthiakassingulangpaaralangalaanlansanganlaronginakyatparurusahannaisfe-facebookforståhelpedguidancesigawfauxtshirtadobomalamanginatakerestauranttwinkleplayscolourdaynaritoiconmakakakainnapakamotbagsaknapatingalakastilangpaghabamamanugangingniyogthesebinigyandespitejackzhimigtvsbutterflytinigilankasiaffiliatetinanggapmaskiconsumebuwanthroathomeawaymagpuntafigurasdonsciencee-explaintagaytaypaskokadaratingkaninoibinigaynanunuksohumaloilalagayinventadosumimangotperwisyopalibhasabagamaikinatatakotkinatatalungkuanggayundinlumiwanagobservererpatutunguhankahirapanlapattinawananrealistictumatawadnagbuntongguidefeltpakikipagbabagpagkagustodoble-karapagkabuhaygagawinsalbahengmagdamagannailigtasdaramdaminkalaunanpaulauniversitymakaiponnanonoodmaglarohulihanpamumunomaisipmaibigayunansementongnatinagkaliwabibigyannatakotbinawianiikotsasapakindadalonilalangvariedadmagdilimtagalnapanagpamasaheriquezanagsulputanstuffedmatigaskasalananpangilyeymalapitanpakisabikalawangingtig-bebeinteroofstockblusanggodtsoccerpaghahanapmagtipidkasaysayanmarvinshowerdininagbentapaghamakbuwalinilagaytanimmoodkabibielectionssaanbarnescarenagngingit-ngitfuelpopularizenamalagiorderin