Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "overall"

1. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

2. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

3. Limitations can impact one's career, relationships, and overall quality of life.

4. Limiting alcohol and caffeine intake can improve overall health.

5. Limiting the consumption of processed foods and added sugars can improve overall health.

6. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

7. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

8. Overall, television has had a significant impact on society

9. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

10. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

11. Work-life balance is important for maintaining overall health and wellbeing.

Random Sentences

1. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

2. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

3. Sa kasawiang-palad ay tinamaan ang magkakapatid at agaw-buhay na bumagsak sa tubig.

4. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

5. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

6. "Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan" ay isang bukambibig na nagpapaalala na mahalaga ang pag-alala at pagpahalaga sa mga pinagmulan.

7. Bawal magdadala ng baril sa loob ng paaralan dahil ito ay delikado sa kaligtasan ng mga estudyante.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. Nous avons choisi une chanson spéciale pour notre première danse.

10. Kailangang pag-isipan natin ang programa.

11. Para sa anak ni Consuelo ang T-shirt.

12. Ang pagkakaroon ng sapat na tulog ay nagbibigay ng malinaw na pag-iisip at pagiging masigla sa bawat umaga.

13. The fashion designer showcased a series of collections, each with its own unique theme and style.

14. Football players wear special equipment such as shin guards to protect themselves from injury.

15. A quien madruga, Dios le ayuda. - The early bird catches the worm.

16. Nagpaluto ako ng adobo sa nanay ko.

17. Sa Taal, Batangas matatagpuan ang Mabini Ancestral House na pinaniniwalaang bahay-bata ni Apolinario Mabini.

18. El arte callejero es una forma popular de arte urbano.

19. Kangina pa ako nakapila rito, a.

20. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

21. Ang mga tao na gumagamit ng droga ay maaaring tumanggap ng tulong sa mga rehab center upang magbago ang kanilang buhay.

22. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

23. Sa pagguhit, mahalaga ang tamang pagbigay ng shadows at highlights upang makalikha ng dimensyon sa isang drawing.

24. We should have painted the house last year, but better late than never.

25. Sa Calamba, Laguna ipinanganak ang pambansang bayani na si Jose Rizal.

26. La letra de una canción puede tener un gran impacto en la audiencia.

27. Ayaw ko ng masyadong maanghang/matamis.

28. Nakisakay ako kay Jose papunta sa airport.

29. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

30. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

31. Ang haba ng prusisyon.

32. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

33. Pagod na ako at nagugutom siya.

34. Los efectos a largo plazo del uso de drogas pueden ser irreversibles.

35. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

36. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

37. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

38. Patuloy ang labanan buong araw.

39. Tinapos ko ang isang season sa netflix kaya napuyat ako.

40. I like how the website has a blog section where users can read about various topics.

41. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

42. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

43. Umutang siya dahil wala siyang pera.

44. Kapag nalulong ka na sa droga, mahirap nang magkamit ng kaganapan sa buhay.

45. Keep in mind that making money online takes time, effort, and patience

46. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

47. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

48. Nalugi ang kanilang negosyo.

49. Kapag aking sabihing minamahal kita.

50. Papasa ka kung mag-aaral ka ng leksiyon mo.

Recent Searches

ipanlinispootoverallahitwaterkalandyanfridaytools,pasyapagbahingipagamotsteeroftedidingdingginparatingmonetizingceslaterbubongofferkararatingkaparehacommunicationsmagkaibatheirmacadamiarenombrepinagmamalakinakakapagpatibaynakaramdamaraw-arawpahahanapdoble-karasasagutinnagmungkahitinaasanskills,kahirapannapaiyakkinakabahansinakopkagandamayumingnabighanipakikipagbabagdiwatamakakibopagkasabimanatilipawiinnalamanmagdamaganmagtigildadamadungishawaiinasagutankakainnakainomkakilalanaglutopaghaliknakatitignakataasmagkasakitmaghahabitindamakukulaypaaralanunancruzkaliwanatinaghawaknaiiniscosechar,sugatangproducerersementongunconventionalisinamanaglulusakmaskaranabigaynatitirangnatakotkusinabinawiancantidadniyonnamilipitprobinsyadadalopnilitsumasakaybibigyanmahigpitpulgadakubokamalayanbiglaanpayapangnangingilidsocialebestidadustpantomorrowpaketetinapaysurroundingsbobotoilagaygreatlytagakeksportenincidenceltogiverdikyamkapainlinawpublishing,siglokasaysayantoyiigibyeysumamamasasamang-loobsoccersalarinhmmmmmininimizeblusangnasabing1954osakatsakahuwebesdogstaasbisigtoothbrushmanuscriptfeltpanahoncivilizationsiempregabingpinyateleviewingcarelayasniyakapmuchaslasingerobarnesrestawanlaterisknilangpasokplaceconnectingfurywalislapatpagkakatumbapotentialinteriorcommunicatestageperawealthipipilitresponsiblevednalasinginalisitinalimakapilingdevelopextraconstitutionipinalutoberkeleyedit:waitcomputercontentappelecteddesarrollaronposporomagalinglarrykailanmanmario