Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "lazada"

1. Halos lahat ng pwede nyang bilihin ay nasa Lazada na.

2. Lazada has a loyalty program called Lazada Wallet, which allows customers to earn cashback and discounts on purchases.

3. Lazada has a reputation for offering competitive prices and discounts.

4. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

5. Lazada has a strong focus on customer service and has won awards for its efforts.

6. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

7. Lazada has faced criticism over counterfeit products being sold on its platform.

8. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

9. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

10. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

11. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

12. Lazada is an e-commerce platform that operates in Southeast Asia.

13. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

14. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

15. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

16. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

17. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

18. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

19. Lazada's mobile app is popular among customers, with over 70 million downloads.

20. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

Random Sentences

1. Ayaw ko magtangkang magbiyahe nang walang mapa.

2. It’s risky to rely solely on one source of income.

3. Tumango siya at nagsimula nang kumaen.

4. The depth of grief felt after losing a loved one is immeasurable.

5. Basta may tutubuin ako, lahat ay areglado.

6. Ang pag-ikot ng mga isyu at pagkukubli ng mga katotohanan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

7. Natutuhan ng mga mag-aaral ang talambuhay ni Lapu-Lapu bilang isang bayaning lumaban sa dayuhang mananakop.

8. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

9. Gracias por iluminar mi vida con tu presencia.

10. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

11. Nakatawag ng pansin ang masama nitong amoy.

12. Dedication is the driving force behind artists who spend countless hours honing their craft.

13. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

14. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

15. Aquaman has superhuman strength and the ability to communicate with marine life.

16. Ang matanda ay malilimutin na kaya’t kailangan niya ng alalay sa pag-alala ng mga bagay.

17. Sa isang tindahan sa may Baclaran.

18. Pasensya na, masama ang pakiramdam ko.

19. Sa kabila ng lahat ng pagsubok na dumadating sa atin, ang mga kanta ng Bukas Palad ay patuloy na nagbibigay ng pag-asa at liwanag.

20. Naglaba na ako kahapon.

21. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

22. Sa aming klase, tinalakay namin ang iba't ibang anyo ng panitikan ng Pilipinas.

23. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

24. Nasa Cebu si Trina sa Disyempre?

25. Tumayo yung limang babae at lumapit kay Kerb.

26. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

27. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

28. Papunta siya sa Davao bukas ng tanghali.

29. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

30. Pigain hanggang sa mawala ang pait

31. Di Indonesia, pemerintah mendorong pembinaan nilai-nilai keagamaan yang inklusif dan menggalakkan semangat gotong royong berbasis agama.

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. Sa bundok ng mga anito na ngayon ay kilala bilang bundok ng Caraballo itinindig ang krus.

34. Tanggapin mo na lang ang katotohanan.

35. Napatingin ako sa orasan. 12 na ng madaling araw.

36. Me duele todo el cuerpo. (My whole body hurts.)

37. Reden ist Silber, Schweigen ist Gold.

38. Después de una semana de trabajo, estoy deseando que llegue el fin de semana.

39. Ohne Fleiß kein Preis.

40. Hinde kasi ako mapakali kaya pumunta ako dito.

41. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

42. Yeah. Mabuti na muna siguro yung ganun.

43. Plan ko para sa birthday nya bukas!

44. Mag de-dekorasyon kami mamaya para sa kanyang 18th birthday.

45. Kahit malilimutin si Mia, sinisikap niyang ayusin ang kanyang schedule para maging maayos ang kanyang araw.

46. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

47. The team captain is admired by his teammates for his motivational skills.

48. Nasa harap ako ng istasyon ng tren.

49. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

50. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

Recent Searches

natulakpag-indakmonumentophilosophicallazadatiyandialledtibokpersongananghumpaypulongcandidateswondere-commerce,pagpapasancubiclesilyamatulissapatexpertisekasaysayandeletingmagnifykuwebabrasomarangyangjuansisterituturotenermatitigasfrienddalawpusangyepespigastonightmestbairdnagdaramdamsearchsentencesinkdahankasingtigasnunoscottishsupremegabingpalapiteducativastarcilabinilhaninantayoperahansumakaystruggledlifedisposallinawhappenednatalonghigh-definitioniyansikodailyuntimelyvisttodaylargerjanetools,videounderholderimportantespootmasdanlabormegetwalislawscivilizationbarnesartsulamsatisfactionbilerpupuntatabassurgeryfuncionarbrideprobablementeflexiblemuchoslarrybabaedaanditocigarettesmarsofreelancerbillnarininghimiginspiredchecksuminomoffentligamingfarstageeksamhatinglorenainterpretingbulsadecisionstruerolledkalarogitaraablebehaviortutorialspublishedoftenclockcompletestringconvertingbilingmakesgoingclassmatesupportworkingspreadnatuwapagkagisingtumamanapasobrasamang-paladparaanmakauuwitaingafigurasdaramdaminnapipilitannakaisinusuotmagawapanatagpinaulanannakapanghihinakahitchildrenreachtanimsyayanshowbaleheysinasallackpyestaadvancedillegalipaliwanageveningkararatingbabainvestingpocakapasyahanpinatiralumusobantoniotinaynagbentanakabiligumisingnahihiyangkonekescuelashinding-hindilawanakakapuntamediumpinoyteleponomightcharismaticsasamastojolibeelate