Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

63 sentences found for "some"

1. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

2. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

3. Catch some z's

4. Football is also known as soccer in some countries, particularly in the United States.

5. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

6. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

7. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

8. In some cuisines, omelettes are served as a light lunch or dinner with a side salad.

9. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

10. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

11. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

12. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

13. Pull yourself together and show some professionalism.

14. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

15. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

16. Some ailments are preventable through vaccinations, such as measles or polio.

17. Some businesses and merchants accept cryptocurrency as payment.

18. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

19. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

20. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

21. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

22. Some couples choose to have a destination wedding in a different country or location.

23. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

24. Some dog breeds are better suited for certain lifestyles and living environments.

25. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

26. Some fruits, such as strawberries and pineapples, are naturally sweet.

27. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

28. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

29. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

30. Some limitations can be temporary, while others may be permanent.

31. Some of her most famous songs include "No Tears Left to Cry," "Thank U, Next," "7 Rings," and "Positions."

32. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

33. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

34. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

35. Some people argue that it's better not to know about certain things, since ignorance is bliss.

36. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

37. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

38. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

39. Some people have a sweet tooth and prefer sweet flavors over others.

40. Some people invest in cryptocurrency as a speculative asset.

41. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

42. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

43. Some people view money as a measure of success and achievement, while others prioritize other values.

44. Some scissors have adjustable tension screws that allow users to customize the tightness of the blades.

45. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

46. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

47. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

48. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

49. Some viruses, such as bacteriophages, can be used to treat bacterial infections.

50. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

51. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

52. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

53. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

54. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

55. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

56. The king's role is often ceremonial, but he may also have significant political power in some countries.

57. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

58. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

59. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

60. This can generate passive income for you, but it does require some capital to get started

61. TikTok has been banned in some countries over concerns about national security and censorship.

62. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

63. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

Random Sentences

1. Hindi ko alam kung paano ko malalampasan ang aking mga agam-agam tungkol sa aking trabaho.

2. Have you ever traveled to Europe?

3. Pumunta si Clara sa bahay ni Maria.

4. However, there are also concerns about the impact of the telephone on society

5. Einstein's ideas challenged long-held assumptions about the nature of space and time.

6. Kapag may mga hindi malinaw na balita tungkol sa kalagayan ng kalusugan, maaaring magdulot ito ng agam-agam sa mga tao.

7. The wedding reception is a celebration that usually follows the wedding ceremony.

8. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

9. Nous allons visiter le Louvre demain.

10. The traffic on social media posts spiked after the news went viral.

11. Nakita rin kita! ang sabi niyang humihingal

12. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

13. Before a performance, actors often say "break a leg" to each other for good luck.

14. Maraming alagang kambing si Mary.

15. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

16. Napadami ang inom ni Berto kaya't ito ay nalasing.

17. Muchas personas prefieren pasar el Día de San Valentín en casa, disfrutando de una cena romántica con su pareja.

18. Gusto ko ang silid na may malaking bintana para maaliwalas ang pakiramdam.

19. Pneumonia can be life-threatening if not treated promptly.

20. La pobreza extrema puede llevar a la inseguridad alimentaria y la desnutrición.

21. Hindi ba nagdaramdam ang nanay at tatay mo?

22. He collects stamps as a hobby.

23. Ang pag-asa ay nagbibigay ng mga solusyon sa mga problema at hamon sa buhay na hindi magagawan ng paraan.

24. Bunso si Bereti at paborito ng ama.

25. Eh? Kelan yun? wala akong maalala, memory gap.

26. Sa gitna ng gulo, pinili niyang mag-iwan ng mga taong hindi naaayon sa kanyang pangarap.

27. Wala akong opinyon sa bagay na ito, kaya sa ganang iyo, ano ang pinakamainam na hakbang?

28. Last full show tayo. Ano bang pinakamalapit na mall?

29. Wolverine has retractable adamantium claws and a regenerative healing factor.

30. Wala na siguro sya, baka natulog na inantok na.

31. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

32. Anong kulay ang gusto ni Andy?

33. Ang daming pulubi sa Luneta.

34. Ang tagumpay ng aking proyekto ay nagpawi ng aking mga pag-aalinlangan at pagdududa sa aking kakayahan.

35. Sobra. nakangiting sabi niya.

36. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

37. Hay muchas hojas en el jardín después de la tormenta.

38. Kinabukasan ay nawala si Bereti.

39. Di mana bumi dipijak, di situ langit dijunjung.

40. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

41. Kelangan ba talaga naming sumali?

42. Pero mukha naman ho akong Pilipino.

43. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

44. Ang pagkakaroon ng malubhang karamdaman ay nagdulot ng malalim na lungkot sa aming pamilya.

45. Pinilit nyang makipagtagisan sa abot ng kanyang makakaya.

46. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

47. Saka na yun, pag fiance ko na sya saka ko sya liligawan!

48. Nakakamangha naman ang mga tanawin sa lugar nyo Edwin.

49. Sa bawat tugtugin ng kundiman, nabibigyang-katarungan ang mga pinagdaanang sakit at luha ng mga taong nagmamahalan.

50.

Similar Words

something

Recent Searches

ipatuloysome1954formaskangitansinehannabigkasdamdaminkakaantaymonsignorinakyatnyenagsalitaefficientaddingnaiinggitmakingdingdingflashhoweverwifimagpaliwanaggenerabaaudio-visuallysafedesarrollaronlumipadpresyoinastanakaka-inpamasahetilapleasesiguradosariwadespiteitinatagunibersidadleaderskinaresultatresmabigyanmagkaibacalidadtiyancynthiamainithatingginagawananggagamotlorenasirasambitspreadkayapinangalanangkaincontrolanag-aalaynagniningningafterisasabadspiritualdipangmalabohangaringiiklikristonagtatampomaritessettingprutasnapapatinginsalatnakalipasinsektongchildrenshoppinghumakbangkinapanayamshopeesingaporecourtkananplantasipinauutangnakumbinsikategori,fitnessmabaitnaglaoncondobundokhumingapaidanihinpanatagsciencelarongmerrynagbunganagpagawapioneerkasakitrealyamannegrosiskopalasyowaitermatalimokaymeaningpinipisilevnenationalbibilitinapayageskuwebaabundanteipasokmatapobrengumiwasestarvideotsonggotabipagkuwaperwisyoconsumebumagsakpagongsumasakayhandaanmagturoikinakagalitkastilangtinghulihanpinaghatidanmalawakpnilithumiwalaymaglalakadsinipangnakakapamasyalcongratsmapuputibiocombustiblesnapadaantwitchmangangalakalmakasilongpinaulananmaongfranciscoheartbeatsahodnakaakmanaliligoagwadorkauntionebabaumiinitpulitikohmmmmforskelpalapitchooseviewsposterpagiisipgigisingsidokumaenumakbayibinilinakakagalaforcessinghalminamasdanmatulistamadidingnagre-reviewtatlovaledictorianabenesumamaroughhomemauboslunascuandomagisippinunitnapadpad