Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. He has traveled to many countries.

2. Ang daming pulubi sa maynila.

3. Paki-charge sa credit card ko.

4. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

5. Ang mga eksperto sa kalusugan ay nagbahagi ng kanilang mga mungkahi upang mapabuti ang mga programa sa pangangalaga sa kalusugan.

6. Ito na yata ang pinakamatabang babae na nakilala niya.

7. Mahalagang magkaroon ng budget plan upang maiwasan ang pagkakaroon ng utang.

8. The flowers are blooming in the garden.

9. Lumiwanag ang langit pagkaraang umalis ang ulan.

10. She has been making jewelry for years.

11. Wala ho akong kinukuha sa inyong pitaka.

12. Till the sun is in the sky.

13. May himig pangungutya ang tinig ng pulis.

14. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

15. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

16. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

17. Napaka presko ng hangin sa dagat.

18. Nareklamo ko na ho ito pero wala hong sagot.

19. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

20. Kumain ka na ba? Tara samahan kitang kumain.

21. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

22. The patient's family history of high blood pressure increased his risk of developing the condition.

23. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

24. Nag-alok ng tulong ang guro sa amin upang matugunan ang mga hamon ng bagong kurikulum.

25. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

26.

27. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

28. The feeling of frustration can lead to stress and negative emotions.

29. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

30. Ano ang pinanood ninyo kahapon?

31. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

32. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

33. Leonardo da Vinci también pintó La Última Cena.

34. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

35. Ang pagkakaroon ng kinikilingan sa kabila ng malinaw na ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

36. The culprit responsible for the car accident was found to be driving under the influence.

37. Ang sakit ng kalingkingan ay ramdam ng buong katawan.

38. Bumili ka ng blusa sa Liberty Mall.

39. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

40. She carefully layered the cake with alternating flavors of chocolate and vanilla.

41. Members of the US

42. Ibinabaon ng magnanakaw ang kanyang ninakaw na yaman sa ilalim ng puno.

43. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

44. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

45.

46. Namumuo ang pawis sa kanyang anit at sa ibabaw ng kanyang nguso.

47. She's always creating drama over nothing - it's just a storm in a teacup.

48. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

49. Magkasamang tutungo sa lugar na walang sakit, walang gutom, walang hirap.

50. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

Similar Words

following,

Recent Searches

pasahenatatanawfollowingpwedengmangingisdangcaracterizahabitspasasalamatnanigaslugawtraditionalfollowedtusongisinamataksipanunuksonaglabaatensyonnapapatinginpagdamicurtainsarabiahumpaypalayomandirigmanglakadmatabangpangkatnegosyoathenamatitigasenerorestawranwinskaysakingdomchoosemayamanmalihislipadibinentamatarayisamacnicoganitobibigwalngbranchtonightpangingimicanadakwebaattentionbusogbarrocointroduceshowmalabojackyduridaysbirosumakitwordsrolestudentspressidea:matabadrewelectionpedeinisconsidermatulunginnotebookworkdaykaycrazylikelycandidateobstacleseksamlibrepracticadoibabananayoutlinepananakotnaglulusakpulaseparationtermandyskillgenerabaextraimpactedhapdiarmedcomputernapilingwindowexplainevolveamountmitigateelementarysiguropapuntakayanakapangasawainumindagatpamburaibotomaluwagtsakaitinuturobumilidesarrollarpigilannagpapasasamaskidesigningpag-aapuhapfactoresmagtanghaliannakakagalanagpanggapdragonsesamepinaghatidannagkwentosasamahouseholdsbusinessesitakmagbabalanapalitangmabigyanawitanmadilimmedianterightsbibilhinobteneramendmentswikakasakitdangerousamangpagongmonumentoninalandolegislationmeaninggamotseepaghugossinipangsubjecttandaitinuring1973aanhinpagkahapojobspaghakbangnagsasagottravelertiniradorespecializadasmumuramalapitpinakamatapatmakakasahodginugunitanagsusulatkasawiang-paladhunilaki-lakiakalaingpaglalabadamahiwagangnasasabihannapapasayakarunungankumikinigmaglalaropalibhasakaniyaambisyosanginjurymahahalikpaki-drawingtatagalnagmadalingpronoun