Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

2. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

3. Sino ang kasama niya sa trabaho?

4. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

5. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

6. Bukas ay magpapabunot na ako ng ngipin.

7. Hindi maikubli ang panaghoy ng bata habang nilalapatan ng lunas ang sugat niya.

8. May klase ako tuwing Lunes at Miyerkules.

9. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

10. Nakarating na si Ana sa gubat at pumasok sa isang kweba at lumabas ng may dalang basket na puno ng ibat-ibang uri ng gulay.

11. Les sciences de la Terre étudient la composition et les processus de la Terre.

12. Players move the ball by kicking it and passing it to teammates.

13. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

14. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

15. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

16. A, e, nawawala ho ang aking pitaka, wala sa loob na sagot ni Aling Marta

17. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

18. Ang galing nya maglaro ng mobile legends.

19. The company's CEO announced plans to acquire more assets in the coming years.

20. Limitations can be challenging, but they can also inspire creativity and innovation.

21. Umuuwi siya sa probinsiya linggo-linggo.

22. Ang paglapastangan sa mga propesyonal at kanilang propesyon ay isang paglapastangan sa kanilang dedikasyon at pagsisikap.

23. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

24. Magsusunuran nang manukso ang iba pang agwador.

25. Ikaw ang iniisip ko bawat oras ng buhay ko.

26. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

27. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

28. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

29. Nagsisilbi siya bilang guro upang ituro sa kanyang mga estudyante ang tamang edukasyon.

30. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

31. Tatlong linggo kami dito sa Pilipinas.

32. Sapatos ang gustong sukatin ni Elena.

33. Nagtagumpay siya dahil sa lakas ng loob na hinugot niya sa kanyang karanasan sa buhay.

34. Ang malakas na tunog ng sirena ay binulabog ang katahimikan ng lungsod.

35. Tangan ang sinipang pigi, ang buong anyo ng nakaangat niyang mukha'y larawan ng matinding sakit.

36. Leonardo da Vinci diseñó varios inventos como el helicóptero y la bicicleta.

37. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

38. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

39. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

40. Napakaganda ng disenyo ng kubyertos sa restaurant na ito.

41. Iginitgit ni Ogor ang bitbit na balde at kumalantog ang kanilang mga balde.

42. Ang mahal pala ng iPhone, sobra!

43. ¿Cómo has estado?

44. Las hojas del libro están todas marcadas con notas adhesivas.

45.

46. Tinanggal ko na yung maskara ko at kinausap sya.

47. Some fruits, such as strawberries and pineapples, are naturally sweet.

48. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

49. Ang apoy sa kalan ay nagbabaga pa rin kahit patay na ang apoy.

50. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

Similar Words

following,

Recent Searches

followingginagawanaglalabalegislationnapalitangabundantetopichumiwalaybusabusinnakatigilplanhoytasabalotbinulongbosesexcusepasyalagnatdahilisulatjerrysiguradomanymakasalanangkapilingpreviouslyleopookamendmentsfatalmakakabalikbestidamakalingpilingitinuturingsiyapinatiraquezonphilippinengunitkapasyahansampaguitabeerapelyidoradioalingpagtutolbinilhansalitangmakenanghihinamadstagepanginoonmayabangsouthquicklysatisfactionlayasbagongpakakatandaanpalamutinamungagalawmaibavarietytravelerabigaeldispositivonakainpistainterestmagkasabaycosechar,kasoykatutubotindautosomfattendehuniactingincreasedexpertmaubosmetrokinuhakungmaihaharapvariousspeechbabatipidrelevantbloggers,manuksorecentmakakawawamaunawaanmatindingmakamitkurakotmakikiraaniwinasiwassikatapattelefonskyldes,e-commerce,evolvepaghingidingnawalaisamabagkuslinggojoeespadakutodmulighedertataasefficientdumilimadditionallynagtrabahopakistankawili-wilimatapangpaglalaitnobodysumasayawalaysangh-hoynanoodlikesnasuklamlalabassinumangbatokaregladomandirigmangbumabanaturalbevarekakuwentuhanhousenangagsipagkantahanproporcionar11pmoliviaideasnagpakilalagayundinsinasabiellenabrilnamumulasinunodresourcesilingparagraphstilgangpa-dayagonaladditionkumaennaglakadnasiyahankatagalanbillkananposporohanapbuhaypananakithidingpakainteacherkontrabinitiwanmanilbihanpaparusahaniyamotmahiwagangsasakyanreplacedloobyumuyukomaglutoinihandagobernadoryouthmensajesinaabutanriyanhaytinaasanbinuksanngitiulolungsodhinila