Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

2. Napangiti na lang ang binata at sumama sa dalaga, simula ng araw na iyon ay lagi na silang nagkikita.

3. Menjaga hubungan yang harmonis dan menyenangkan dengan orang-orang di sekitar kita dapat meningkatkan kebahagiaan dan kepuasan hidup.

4. Masayang-masaya siguro ang lola mo, ano?

5. Sang-ayon ako na dapat natin pagtuunan ng pansin ang kalagayan ng ating kalikasan.

6. Tango lang ang sinagot ni Mica. Bumaling sa akin si Maico.

7. She has run a marathon.

8. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

9. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

10. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

11. I received a lot of gifts on my birthday.

12. Sa tulong ng isang magandang pagsasalita at pang-unawa, ang tensiyon sa pagitan namin ay napawi.

13. Twinkle, twinkle, little star.

14. The company is exploring new opportunities to acquire assets.

15. Leukemia is a type of cancer that affects the blood and bone marrow.

16. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

17. Gumawa si Mario ng maliit na bola mula sa papel.

18. Sa palaruan, maraming bata ang nag-aagawan sa isang bola.

19. The pretty lady in the movie stole the protagonist's heart.

20. Hindi naman halatang type mo yan noh?

21. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

22. Pumunta kami sa may bar ng bahay nila.

23. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

24. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

25. Alam ko na mayroong magandang intensyon ang kanilang plano, ngunit hindi ako sang-ayon dito kaya ako ay tumututol.

26. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

27. Bigla siyang bumaligtad.

28. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

29. Påsketiden er en mulighed for at tilbringe tid sammen med familie og venner og nyde det forårsagtige vejr.

30. Would you like a slice of cake?

31. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

32. La formación y la educación son importantes para mejorar las técnicas de los agricultores.

33. Goodevening sir, may I take your order now?

34. I love you, Athena. Sweet dreams.

35. Beast. sabi ko pagkalapit sa kanya.

36. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

37. Inihanda ang powerpoint presentation

38. Women make up roughly half of the world's population.

39. Ang lider ng samahan ay pinagpalaluan ng mga miyembro dahil sa kanyang integridad.

40. I am absolutely committed to making a positive change in my life.

41. Size 6 ang sukat ng paa ni Elena.

42. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

43. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

44. Napapagod ako sa bigat ng poot na umaabot sa aking kalooban.

45. Ina, huwag mo po kaming iwan! ang iyak ni Maria.

46. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

47. Coffee shops and cafes have become popular gathering places for people to socialize and work.

48. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

49. Eto ba parusa mo sakin? Ang masaktan ng ganito?

50. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

Similar Words

following,

Recent Searches

business,followingpaliparinmagpahabapadabogcebujagiyapabulongfacenagtinginanpasahebumitaweventoshistoriapagkapasansumakitmaulinigannalamancultivationipinabalikmagsusuottugonilalimcualquiermaninirahannakabiladpulangsquatterrestawrancertainsounddespuesbantulottabainiisipkaninolalakadmightpalaginanlilimahidnakapagproposengunitattackdoktorbadingitemsmisusedshareathenastagemagnakawbilibidagilityclienteyeahprobablementesasakyanmacadamiaanubayanipihitpanggatongnakapagsasakaysampungnagdabogideabranchidea:ayudamagsaingdosnagcurvesagotautomatisknababalotpracticadolibagmenumakalingsamecallingnag-iisangprogramakakayanangmagasawangkaragatanimprovekatibayanghansumigawmakalipasnagliliyabinspirekisstanyaglistahannaaksidentemagkasamatherapydrawingsumandalnanonoodisinarakaawaynakasandiglumbaykapamilyakelanmaliksiuloeksportererkalalumalangoyibinaonmilamagbibigaymaaaritumaliwassinimulannasasalinanpinilitsweetbiyasdyipnibesesnakangisingcultivatedipinadakipeducationalmediatekstlinggongnakapasokdaangnakauwitelangtirangtelefonergayunpamangumagalaw-galawbirthdaynakaupomamayalot,reviewtatlopagtinginmejoburmasaidnamumulaklakhumpaydiettopicpinagagepagkapasokpiecespelikulanagbanggaankulayphilippinetrainssumayapinagbigyantalagangnakabihirainstitucionestraditionalregulering,automationnotebookbaldengtechnologiesmakakabalikpshtsonggotipoperatesenioractiondonttusindvistargettumunoglegenddoublepangakotumalabpreviouslyevolucionadolalakengpangungutyamodernemalamangkikocontent,umupounahinhall