Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Ang ganda ng swimming pool!

2. Mataman niyang inisip kung may iba pang nakakita sa nangyari.

3. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

4. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

5. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

6. I was going to surprise her, but I accidentally spilled the beans.

7. Pakibigay ng oras para makapagpahinga ang iyong sarili.

8. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

9. Talaga? Sige nga ipakita mo nga saken.

10. Ang albularyo ay nagdasal habang minamasahe ang namamagang braso ng pasyente.

11. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

12. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

13. Doa sering kali dianggap sebagai bentuk ibadah yang penting dalam agama dan kepercayaan di Indonesia.

14. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

15. Napakabilis talaga ng panahon.

16. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

17. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

18. Hindi ko nakita ang magandang dulot ng kanilang proyekto kaya ako ay tumututol.

19. La realidad es que las cosas no siempre salen como uno espera.

20. Ang pagsisimula ng malakas na away sa loob ng tahanan ay binulabog ang katahimikan ng pamilya.

21. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

22. Landbrugsprodukter, især mejeriprodukter, er nogle af de mest eksporterede varer fra Danmark.

23. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

24. Eine klare Gewissensentscheidung kann uns helfen, uns selbst und andere besser zu verstehen.

25. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

26. Mahilig si Tatay manood ng laro kung saan ang gamit ay bola.

27. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

28. Sa ganang iyo, ano ang pinakamagandang gawin upang mapaunlad ang ating bayan?

29. Likas na mabait si Perla pasensiya na lamang ang kaniyang binibigay sa kapatid na si Amparo na ubod na tamad.

30. Kantahan mo si Noel ng Kumanta ka ng kundiman

31. The management of money is an important skill that can impact a person's financial well-being.

32. Nagtatanim ako ng mga gulay sa aking maliit na taniman.

33. Ailments can be a source of stress and emotional distress for individuals and their families.

34. Ano ang pinag-aaralan ni Cora?

35. Maraming natutunan ang mga estudyante dahil sa magaling na pagtuturo ng guro.

36. Bagamat modernong panahon na, marami pa rin ang pumupunta sa albularyo sa kanilang lugar.

37. Umiiyak siyang gumuglong sa basa at madulas na semento.

38. A couple of dogs were barking in the distance.

39. Wala na naman kami internet!

40. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

41. La música es un lenguaje universal que trasciende las barreras del idioma y la cultura

42. ¿Puede hablar más despacio por favor?

43. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

44. Gracias por entenderme incluso cuando no puedo explicarlo.

45. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

46. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

47. The early bird catches the worm.

48. At isang araw nga, nagpasya sina Damaso at Magda na tumakas at mamuhay sa ibang lugar.

49. Binili niya ang bulaklak diyan.

50. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

Similar Words

following,

Recent Searches

followingpayapangbiglaanmaestraherramientaslilikobayaningnatigilanfaultfremstillelettergrinsredigeringlendingipapaputolfonoslumbayyariseesufferlumakaskasapirinprimeroruganilapitankabarkadamaghintaykakahuyantondobumuhosothersnewsadyangmusicianspagdamibuwayapagkainggabisalatinbehavioramendmentspatrickmatikmanpinalitanmanilasumimangotanongmarteshuwebeszoonaggalainterestsmapahamakmalambingmachinestulalaupuanmaayosipinatawagsapilitangdesarrollarsisidlannaisbumilipreviouslypangilcompositoressineproudtsaka1954memberssalahehetaingahusoattentionfar-reachingdreamorderinmaarilapitantinanggapinfluencesbarobingihdtviilanbeganguroencompassesespigasmoderneteleviewingmaluwangadversesumabogkanilangabigaelproperlyjokeyeloatentopinalutodalandanverymegetburmaenchantedindvirkningdagaconectadospanitikan,kagandahantodoitakpusomoodanimodolyarableroboticcebucoatsuelodeveloped1973ipinikitmapaikotdedication,hamaksumasambapitakawatchingmasayang-masayangmatchinglimosmaalogstarpagbahingtanimfridaytools,janegabefonopasangbellmapuputiconsiderednakagagamotromerowakaspedebarongunderholderinvitationtangingso-calledyoungoueallergyfeelmuchosnag-oorasyonpaulpanochangeexpandedmabirotransitshapingkamukhamanyconocidoskakapanooddinipagpasokfigureskapintasangmeansrailtrippalagingkumarimotsetyembrepulgadasciencestonehamdemocracycomematulunginincreasedbevareiinuminsharing1982impitapollomacadamia