Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. The clothing store has a variety of styles available, from casual to formal.

2. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

3. Puwede ba sumakay ng taksi doon?

4. Ang mga pangarap natin ay nagbibigay sa atin ng inspirasyon upang magtrabaho nang husto.

5. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

6. Sa gitna ng mga problema, hindi ko mapigilang maglabas ng malalim na himutok.

7. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

8. Nag-aabang sa langit, sa mga ulap, sumisilip

9. Anong kubyertos ang hiningi ni Maria?

10. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

11. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

12. Kay hapdi ng kanyang batok at balikat.

13. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

14. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

15. Nang gabi ngang iyon ay hinintay ni Mariang Maganda ang kanyang iniirog.

16. Ariana Grande is also an advocate for mental health awareness, openly discussing her experiences with anxiety and PTSD.

17. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

18. Ang pusa ay naglaro ng bola ng sinulid buong maghapon.

19. Hindi pa ako nakakapunta sa Barcelona.

20. Pumunta kami sa Cebu noong Sabado.

21. Pagkatapos kong ipagbili ito, bibili ako ng pagkain natin.

22. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

23. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

24. Mahina ang signal sa kanilang lugar, samakatuwid, nahirapan siyang makipag-usap sa telepono.

25. Mag-ingat sa aso.

26. He is having a conversation with his friend.

27. Pagkatapos nila mag-usap at pagkapasok ni Helena sa kanyang kwarto ay nilapitan ni Haring Bernardo ang binata at kinausap ito

28. Si Ben ay malilimutin pagdating sa mga petsa ng okasyon, kaya lagi siyang may kalendaryo.

29. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

30. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

31. Hindi ako masyadong mahilig sa pagpupuyat sa hatinggabi dahil masama ito sa kalusugan.

32. He is not driving to work today.

33. Matagumpay na nagwagi si Wesley laban sa kasalukuyang kampeon ng boxing.

34. Ang carbon dioxide ay ina-absorve ng mga puno.

35. Hanggang sa dulo ng mundo.

36. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

37. Kumain na kami ng tanghalian kanina.

38. Napatakbo ako sa kinalalagyan ng landline ng tumunog yun.

39. Sa panahon ng tagtuyot, mas tumitindi ang init ng araw.

40. Min erfaring har lært mig, at tålmodighed er en dyd.

41. Natutuwa ako sa magandang balita.

42. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

43. They are not building a sandcastle on the beach this summer.

44. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

45. At have en klar samvittighed kan hjælpe os med at træffe de rigtige beslutninger i pressede situationer.

46. Pnilit niyang supilin ang hangaring makasilong.

47. Masaya akong pumasok sa silid-aralan dahil mahilig ako sa pag-aaral.

48. Kanino ka nagpagawa ng cake sa birthday mo?

49. Alam kong parang biglaan, pero sana pwede ba kita makilala?

50. Ah eh... okay. yun na lang nasabi ko.

Similar Words

following,

Recent Searches

lalofollowingpagbatimaskaraumupouwaksinasadyagagambaawardnocheadecuadoenglandhumpaykaragatansayawanpaketebutaskumustainventionheartbeatflamenconatitiraopportunityprobinsyadalawinligaligmaibabaliksinisicandidateskayokinalimutannogensindenataposkainanknightherramientakombinationkatapatsumingitbalatincidenceklasenglagunasumisiliphoykumbentotinitindakulotbinibilangalakelenautilizainventadomatayogbaryopabalangsumpainlarangannapagoddinanascoalsikolaybrarikahilingannagpuntatwo-partymagtipidltokananelectoralbilibpongdumaannahihilonaglabananwidelymaidinihandathankpanindangbalangmatulismasdankatabingtelangknownritohigitjoshfueprimercupidgatheringresignation1940grewuboddeterioratecanadaiguhitorderinbotokabosesbarosalarinbotantelagibirobagbuwalcareerprovedemocraticbarriersguardaprobablementecafeteriaunderholderglobalmatangbinabalikroseotrobumababatanimpshdagashortsoresobrakwebangjaceeksenalegendsaledidclassroomschedulespaghettithroughoutinuminluisemailsumalamacadamiasumalicomplicatedminuteoncemuladitosaringcornersirogbiggest18thdecreasestringknowledgeformscomplexincludebatabasabituinsolidifyautomaticcomputerevolvedworkshopdulohighestformatmulinginteractfallreturnedlargecomunicarseinfinityshouldthreeunangnakatitiganidollardancegeneratelikelyspeechnaggingumilingalinrightagestudentsyangaddfacilitatingeye