Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Sakay na! Saan ka pa pupunta?!!

2. Hindi ka man makahanap ng kasama, mayroon kang kaulayaw sa loob ng puso mo.

3. Emphasis can be used to create a sense of drama or suspense.

4. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

5. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

6. Tahimik ang buong baryo sa takipsilim.

7. We celebrated their promotion with a champagne toast and a slice of cake.

8. Ang paggamit ng droga ay hindi lamang masamang bisyo, kundi pati na rin isang krimen laban sa iyong sarili at sa lipunan.

9. Nilaos sila ng bata at dahil dito, mas lalong yumabang ang bata.

10. Hinampas niya ng hinampas ng kidkiran ang binatilyong apo.

11. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

12. Lumapit sakin si Kenji tapos naka smile siya.

13. Sayang, kenapa kamu sedih? (Darling, why are you sad?)

14. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

15. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

16. Magtanim na lang tayo ng puno para makatulong sa kalikasan.

17. Agad na kinuha ni Mang Kandoy ang kanyang itak at tinaga ang mangkukulam.

18. Les préparatifs du mariage sont en cours.

19. Sa kabila ng mga pagsubok, hindi siya sumusuko at pinagsisikapan na mapabuti ang kanyang buhay.

20. Ang kotseng nasira ay kotse ni Jack.

21. They have been running a marathon for five hours.

22. Pneumonia can be caused by bacteria, viruses, or fungi.

23. Hindi mo na kailangan ang magtago't mahiya.

24. Ito ho ba ang pinauupahang bahay?

25. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

26. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

27. Get your act together

28. Balak po naming bumalik sa susunod na linggo.

29. Napalayo ang talsik ng bola nang ito’y sipain ni Carlo.

30. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

31. Hindi na nakita ni Aling Rosa si Pinang.

32. Sa kanyang pagbabasa ng libro, biglang napadungaw ang kanyang mata sa isang nakakatuwang larawan.

33. Einstein was offered the presidency of Israel in 1952, but declined the offer.

34. Uno de mis pasatiempos favoritos es leer novelas de misterio.

35. Sa pagkawala ng kanilang tahanan, naghihinagpis ang mga pamilyang apektado ng sunog.

36. Inakalang wala nang natirang pagkain, pero may tinapay pa pala sa mesa.

37. Les biologistes étudient la vie et les organismes vivants.

38. Gaano ka kadalas pumunta sa doktor?

39. Ang kahulugan ng duli ay tinik pagka't siya ay laging nagbibigay ng ligalig sa kanyang mga kaaway.

40. La creatividad nos lleva a explorar nuevos caminos y descubrir nuevas posibilidades.

41. I know they're offering free samples, but there's no such thing as a free lunch.

42. Después de estudiar durante horas, necesito un descanso.

43. She admires the bravery of activists who fight for social justice.

44. Nakisakay ako kay Jose papunta sa airport.

45. Hindi umano totoo ang mga balitang nag-resign na ang presidente ng kumpanya.

46. You reap what you sow.

47. Ang mabangong lotion ay nagbibigay ng pag-aalaga sa balat at magandang amoy.

48. Nakakamangha ang mga tanawin sa isla.

49. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

50. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

Similar Words

following,

Recent Searches

disensyohistoriafollowingtumingalalolamagpakaramitalinopaliparinbrasonasaangasukalpinataymaglakadtusongtaksikaninajeepsisentaminahankastilanagsimulanuevoseroplanomasayangmatutongdecreasemalayonglayuantuluyang11pmumigibkumuhabeautynandooncubapakiramdammetodisknamantawanane-commerce,hinintaygjortbutaspinag-aralanmagdilimperseverance,sakaynatayocashnatingalahawakmalimutankinahuhumalinganpalaisipanstreettongracialmatitigasrememberedasiabobotopulitikomonumentodiseasesbinibiliparoroonacheckspinyuansapatumalisginawamakauwiparurusahansapotninyomagnifylayawnaispresleymasipagnag-alalapaboritongalamidbutchmagisingduraslegacystruggledfilmsgodtpangalanbangkokananiyonphysicalnatuyonagpalutoasksumaliwcityadicionalesbotogivekalakinghuwebestwitchxixsupremeagadsumakayoperahannapagsilbihanpagkakakulongnagalitmarianconnectingveryyelomaiscanadabusiness,seeandamingindividualattentiondiagnosticmatatalopagkokaksanggolneanagkakatipun-tiponnakiramaycommunicationsnamumukod-tangimarsobrightaudio-visuallycongratstools,pics10thloriklimamatchingbiennagsisilbihimigdingdingpeterbroaddebateseyehalikaconsiderarprovide1990vasquesswimmingnegro-slaveslooblumungkotnagsiklabpinanoodniluloncreateknowledgecanteenilingjunjunrangeinfinityberkeleyhumanapmitigateclientepisiclassmateimpactedmagpapaikotibat-ibangcolornagmumukhananlilimahidpananimimulatmaglaropakikipaglabannanghuhulipanimbangnabiglapinalambotnatatawanahihirapanartistsdealplacesakimyunpinagbubuksanout