Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Mag-ingat sa aso.

2. I'm going through a lot of stress at work, but I'm just trying to hang in there.

3. Ano ba problema mo? Bakit ba ayaw mong magpa-ospital?!

4. Medarbejdere kan blive tvunget til at arbejde hjemmefra på grund af COVID-19-pandemien.

5. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

6. Napansin niya ang mababa ang kita ng tindahan nitong buwan.

7. I am absolutely grateful for all the support I received.

8. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

9. Ang pagkakaroon ng sapat na tulog ay nakakatulong sa pagpapanatili ng tamang timbang.

10. Mayroong dalawang libro ang estudyante.

11. Ang mga punong-kahoy ay hindi lamang maganda

12. Ada udang di balik batu.

13. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

14. Maglalakad ako papuntang opisina.

15. Pakipuntahan mo si Maria sa kusina.

16. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

17. Hinugot ko ang papel sa loob ng envelope.

18. Uh huh? medyo naguguluhan kong sabi.

19. Ahhh...wala! Bakit ba, nagdadasal ako noh!

20. Halos maghalinghing na siya sa sobrang pagod.

21. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

22. Hmmm natutulog yung tao eh. Wag ka ngang sumigaw.

23. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

24. Maraming hindi sumunod sa health protocols, samakatuwid, mabilis kumalat ang sakit.

25. Nous allons visiter le Louvre demain.

26. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

27. Ngunit wala siyang nararamdaman sakit.

28. Gusto kong namnamin ang katahimikan ng bundok.

29. Kung gusto may paraan, kung ayaw may dahilan.

30. Les employeurs peuvent utiliser des méthodes de travail flexibles pour aider les travailleurs à équilibrer leur vie professionnelle et personnelle.

31. Emphasis can also be used to create a sense of urgency or importance.

32.

33. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

34. Isang malaking pagkakamali lang yun...

35. Ow, sorry nagising ata kita. aniya.

36. Ginawa niya ang lahat ng makakaya niya sa kompetisyon, samakatuwid, walang dahilan para siya ay malungkot.

37. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

38. Wala yun. Di ko nga naisip na makakatulong. aniya.

39. Hindi nya masikmura ang harap-harapang panloloko ni mayor sa kanyang nasasakupan.

40. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

41. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

42. Maraming taong nakakalimot sa kababawan ng buhay dahil sa materyal na bagay.

43. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

44. Ofte bliver helte hyldet efter deres død.

45. Binuksan ko ang pintuan ng condo ko at binuksan ang ilaw.

46. Después de desayunar, salgo a correr en el parque.

47. Anong ginagawa mo?! mataray pang sabi nito.

48. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

49. Magalang na nagsabi ang estudyante ng "po" at "opo" sa kanyang guro bilang pagpapakita ng respeto.

50. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

Similar Words

following,

Recent Searches

followingbagalmarahillamigfriendtoothbrushmatitigasitohigaanlivestrajedailygirlkatabingpointtrueipaliwanaglawsbeginningssinraisebakuranmagpapagupitbalitalikuranmagasawangnagtutulaknakalilipasnagkapilatmakidaloentrancedisenyongpagkakamalinanghihinamadmakapangyarihanpagpasensyahannagpalipatobservererkumukuhanakikini-kinitapagsumamopepekumalmatangekslumamangmawawalapinasalamatannaabutanaplicacioneshayaanfilipinanalakikumidlatiniindapaghuhugasprimerosna-fundkilongkamandagnalamannaglokopawiinkaninumansumusulatinlovemaghilamosmilyonggawaingika-12estasyonnaghilamosstorytinahakpagbebentaumulanpaakyatsapagkatde-latakastilamaaksidentematagumpaypapayanaghubadrespektiveconvey,marielaustraliaahhhhgasmenpokerbanlagipinambilitransportretirarnagplayunconventionalnasundoupuanhoyenergywednesdaytigaspaketeanumancocktaildisenyobutidiseasehindekararatingwastodiyosutilizarnagisingtusindviskahitkapainabangannaglabanansisteriyakparkebusystruggledhumblemalumbayiyanviolencenuhhappenedhapag-kainannakikitavalleykatandaansinampalaniyabinasatanodgranadatsakamalambingbasahinvelstandtumangomanlalakbaymagbigayanmagkahawaknagdaankalayaaninsteadnapakasipagcarddollytonaccedercomienzantendersearchleopolonamnalalaglagnagbanggaandeathika-50natabunanduwendepagluluto11pmrosarioremainadicionalesgrinsarbejdermassesfreesalasparenakasuotmakasarilingpangilbalekaringiniswealthstatusofficeburdenyancoaching:sumalianisinetatanggapincomelotwaitinfluencekahapontahanan