Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Sinuman sa kaharian ay walang makapagbigay ng lunas.

2. Nagitla ako nang biglang may kumatok sa pinto.

3. Kaagad namang nakuha ng mangangahoy ang kanyang palakol kaya't nasugatan nito ang tigre sa leeg nito.

4. Ipanghampas mo ng langaw ang papel.

5. At sa paglipas ng panahon, naging malakas na ang lalaki na nakilala nilang Damaso.

6. The number of stars in the universe is truly immeasurable.

7. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

8. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

9. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

10. Ang guro ko sa Ingles ay nagturo sa amin ng iba't ibang uri ng pangungusap.

11. La pimienta cayena es muy picante, no la uses en exceso.

12. Gaano ho ba kalaking lupa ang gusto ninyo?

13. A lot of rain caused flooding in the streets.

14. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

15. Libre si Clara sa Sabado ng hapon.

16. Excuse me, may I know your name please?

17. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

18. They have been volunteering at the shelter for a month.

19. Kailangan kong magtiwala sa aking sarili upang maalis ang aking mga agam-agam.

20. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

21. Cryptocurrency is often subject to hacking and cyber attacks.

22. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

23. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

24. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

25. Si Apolinario Mabini ay kilalang bayani ng Pilipinas.

26. Maganda ang kulay ng langit sa dapit-hapon.

27. Lasinggero ang tatay ni Gabriel.

28. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

29. Aquaman has superhuman strength and the ability to communicate with marine life.

30. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

31. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

32. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

33. Sus gritos están llamando la atención de todos.

34. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

35. Ang pag-asa ay maaaring magdulot ng positibong pagbabago sa buhay ng mga tao.

36. Research and analysis are important factors to consider when making investment decisions.

37. Hindi siya makabangon at makagawa ng gawaing bahay.

38. Unti-unting lumapad yung ngiti niya.

39. Gusto kong maging maligaya ka.

40. Like a diamond in the sky.

41. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

42. Mabait ang pamilya ni Aling Juana kaya panatag ang loob ng ama't ina ni Bereti.

43. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

44. Nagpapadala ako ng mga kanta at mensahe sa aking nililigawan upang ipakita ang aking pagmamahal.

45. Dahil dito, walang may gustong makipagkaibigan sa kanya.

46. Ano ang pinabili niya sa nanay niya?

47. Ang pagiging makapamilya ay isa sa pinakamagandang katangian ng mga Pinoy.

48. Nagtagumpay siya sa kanyang agaw-buhay na laban sa kanyang sakit.

49. Naniniwala ang ilang tao na ang albularyo ay may kakayahang mag-alis ng masamang espiritu.

50. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

Similar Words

following,

Recent Searches

followingkainitancruzlupainkutsilyosinimulankayakapage-commerce,consideruniqueelitemapaikoteeeehhhhslavemagkakagustopangungutyanagkakakainnagpapaigibdekorasyontenmakauuwimagtablepinatutunayanpronounnagsasagottatawagkapatawaranmahiyahimihiyawibinilimonumentonasiyahanmahinogumiwasnaliwanaganpinagawanearkapitbahayumiibigmangyarimaasahankommunikererintramurosmanilbihanpumayagadvancementkailanmannuevosmaibigaysiyangbarangaykumustapag-itimkauntibirdsnatitiranaiwangarabiaalagatatlorobinhoodteachercarriesmagnifyfe-facebookpinalayassangaparehaspa-dayagonalasopagtataasunahinbecamedahankinantaedsagivermawalasemillasbagyongdangerousbevarehdtvcomputere,inulitinantaytshirtubohinigitreguleringaniyaoposangipaliwanagneakapenapatingalaokaychildrenxixtiketsentencebeginningscitizenlintajacebaulsumasambacryptocurrencymightjoshallottedcupidrabetuwangsalamaispaskoguhitheyirogmapuputisaringvotesumiilingrosedemocraticmurangbluerestawanmatangjane10thkaraoketaga-suportasumapitdonemacadamiatheseconclusionhomeworksumangenchantedconventionallackmuchosbilermentalprovideginisingbabebeginningipapahingahimselfdancecandidatereporteyehatinglorenalangdaddyexpectationsadditionallyincreaseroughviewdraft,alignscountlessskillgotregularmentedeclareeveryinterioritloghimigbalik-tanawdecreaseincludeprogrammingsequedulosolidifyinsteaddoingclienteeditoractorremotemanamis-namispare-parehonasagutansabadolumiwagpamahalaannagpaalam