Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. La música española es rica en historia y diversidad, con una variedad de géneros y estilos

2. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

3. Ada udang di balik batu.

4. Ano ang nasa kanan ng bahay?

5. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

6. Itinago ni Luz ang libro sa aparador.

7. Sigurado ka ba dyan, Kenji? tanong ng dad ni Athena

8. Bumibili ako ng maliit na libro.

9. He has been practicing the guitar for three hours.

10. Nasa ilalim ng mesa ang payong.

11. Anong oras gumigising si Cora?

12. Size 6 ang sukat ng paa ni Elena.

13. Mas maganda tingnan ang mga bulaklak sa dapit-hapon dahil kakaiba ang ilaw ng araw.

14. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

15. Einstein was offered the presidency of Israel in 1952, but declined the offer.

16. Nareklamo ko na ho ito pero wala hong sagot.

17. He was hospitalized for pneumonia and was on a ventilator for several days.

18. Malapalasyo ang bahay ni Ginang Cruz.

19. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

20. Pull yourself together and focus on the task at hand.

21. Cuídate mucho en ese barrio, hay algunas zonas peligrosas.

22. She has collaborated with several prominent artists, including The Weeknd, Nicki Minaj, and Lady Gaga.

23. Anong karangalan ang ibinigay sa kanya?

24. Mahilig si Tatay manood ng laro kung saan ang gamit ay bola.

25. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

26. Kapag may mga hindi malinaw na plano sa buhay, maaaring magdulot ito ng agam-agam sa mga tao.

27. Masaya at masaganang na naninirahan ang mga tao dito nagtutulungan at nagbibigayan din sila, kung tutusin perpekto ang bayang ito.

28. Dapat nating linisin ang mga kubyertos bago natin gamitin.

29. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

30. El mal comportamiento en clase está llamando la atención del profesor.

31. Pumunta ka dito para magkita tayo.

32. Naglalaro ang walong bata sa kalye.

33. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

34. The political campaign gained momentum after a successful rally.

35. Malapit lamang pala ang pinaghatidan nito ng tubig.

36. Ang sugal ay isang hindi maiprediktable na aktibidad na nagdudulot ng excitement at thrill sa mga manlalaro.

37. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

38. Nang magretiro siya sa trabaho, nag-iwan siya ng magandang reputasyon bilang isang tapat at mahusay na empleyado.

39. Nagmadaling maglakad si Kenji papalapit sa amin ni Lucas

40. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

41. Ang paggamit ng mga apps at gadgets bago matulog ay maaaring makaapekto sa kalidad ng tulog ng isang tao.

42. Namnamin mo ang ganda ng paligid sa takipsilim.

43. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

44. Ang pagpapalit-palit ng oras ng pagtulog ay maaaring makapanira sa sleep cycle ng isang tao.

45. Ang haba na nang bigote mo, mag ahit ka nga!

46. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

47. Umalis sa sakayan ang mga pasahero nang limahan.

48. Ang aming angkan ay kilala sa aming lugar dahil sa aming mga tradisyon.

49. Though I know not what you are

50. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

Similar Words

following,

Recent Searches

followingumokaymadadalanaawahiramnilaoshinamakkamalianiwanankainanwonderplanning,retirarjolibeesementomalawaknatayokaniyamassachusettsnanigassahigtransportdiaperbuwayadustpanbutaskabarkadamarielshoppingexperts,adecuadococktailindependentlysiratamismalapitannanaysistersinungalingkendibumuhosbooksstreetmayabongofrecenreynapublicationsumisilipaddictioncarriesnamaplagasdeletingkulangmayamangdasalsilyaninyoumakyatvelstandsignfulfillingkapainparinhappenedtambayantsakabutchstocksmataraybateryataaswerelendingbigoteagadeuphoricpabalangiikliresumenmadurasfameindustrykonekdawbatoplacehangaringtapossiyapagodproductioncellphonehidingomeletteipaliwanaglatememorialperlamalagosakinsumasambabaulsumindimaalogpicspuedechavitspendingburdenipinikitoncedatiguestsroboticmapuputi10thflexiblemeetelectionspag-aapuhapduloartificialsutilinterpretingcontinuesreportferrervismobilefansinalalayanhomeworktextofallstartedtypesinfinityrelativelyipinalutomalakingbeingdingdingdanceskillbalitanagsisigawmagpakasalnapililarongpag-aanitog,problemahverfilmsbangladeshpag-isipanadicionalestagpiangpetsamaghahandanagbuwismalayangpangyayaringmahiwagangpandidirivirksomhedermakapaniwalamerrypagguhithojasinternetpalapitaminnararanasanpinakidalamanoodpitokanilainternal1982pinatidhiwasubject,salu-salolaromagtakakayaikinakagalitikinagagalakmagpalibrepag-iwancualquiernapatinginpagkatdaanmakatilagunamalamiglinggo