Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Ginagamit ang salitang "umano" upang ipahiwatig na ang isang pahayag ay hindi pa tiyak at batay lamang sa sinasabing impormasyon mula sa ibang tao o ulat

2. Bye! liliko na sana ako para mag-iba ng exit.

3. Han blev forelsket ved første øjekast. (He fell in love at first sight.)

4. Money can take many forms, including cash, bank deposits, and digital currencies.

5. The credit check for the apartment rental revealed no red flags.

6. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

7. Beauty ito na oh. nakangiting sabi niya.

8. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

9. Gusto nilang sumakay ng dyipni sa Pilipinas.

10. No tengo palabras para expresar cuánto te agradezco.

11. Limang buwan na rin kami nitong si Beauty.

12. Hindi ka sanay sa matinding init? Kung gayon, manatili ka sa lilim o sa malamig na lugar.

13. Napahinga ako ng malakas kaya napatingin siya sa akin

14. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

15. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

16. Not only that; but as the population of the world increases, the need for energy will also increase

17. Road construction caused a major traffic jam near the main square.

18. Sa gitna ng unos, ang kanilang mga panaghoy ay dinig hanggang sa kabilang baryo.

19. The impact of the pandemic on mental health has been immeasurable.

20. She is playing with her pet dog.

21. Ngayon ko pa lamang nakita ang halaman na ganito.

22. Pakibigay ng oras para makapagpahinga ang iyong sarili.

23. Happy birthday sa iyo!

24. Has she read the book already?

25. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

26. Tumagal ng tatlong oras ang kanyang operasyon.

27. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

28. Traveling to a conflict zone is considered very risky.

29. I am not watching TV at the moment.

30. Dahil sa pandidiri ay nilayuan niya ito pero ang pulubi ay humabol at nagmakaawa.

31. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

32. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

33. Ang mga mamamahayag ay nagsusulat ng mga balita para sa pampublikong impormasyon.

34. Pagkatapos ng ilang taon, nagulat siya nang makasalubong niya ang dating kaklase na matagal na niyang nakalimutan.

35. Sa aking silid-tulugan, natatanaw ko ang ganda ng buwan na sumisilay sa bintana.

36. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

37. Sa droga, walang kasiguraduhan kundi kamatayan.

38. ¿En qué trabajas?

39. Binati niya ito ng "Magandang umaga sa iyo".

40. Naging malilimutin si Carla mula nang magkasakit siya.

41. Pagkalipas ng dalawang linggo ay nakatanggap si Nicolas ng sulat galing kay Haring Bernardo.

42. Nagbuntong hininga sya, Akala ko naman.

43. Sa mga siyudad, mahalaga rin ang mga punong-kahoy dahil nakakatulong ito sa pagpapalinis ng hangin.

44. Twitter was launched in 2006 by Jack Dorsey, Biz Stone, and Evan Williams.

45. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

46. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

47. We have been married for ten years.

48. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

49. Maganda ang ginawang dekorasyon sa cake ni Abigael.

50. I have been jogging every day for a week.

Similar Words

following,

Recent Searches

followingpagkabiglausedduonnakapagreklamoshadesbingibakesakupindaangadvertisingmembersnakitulogtaksitulangnagtitiismagkasabaymagtiwalakailanyeyinastastobanalagemediumhimignakilalanakalocksantohuniinalagaannagpepekeiintayinpaumanhinkumitamahahalikvelstandgananapakagagandamaaarieditorminahannagsisipag-uwiantonightcigaretteeventatanggapinnaglalakadtangekstsinelasilalagayomelettenalalabingjackymakakatakaskilobaldematarayspecificmangingisdaklasruminfluentialiwananflyalaalanagtagisanmagisipgabrielerapmagpuntadiseasesnakikilalangestarnaisdoktorkastilangimpactbarongestablishincluircomunespalagikabibicandidatesdealkarunungankababalaghangkumalmakasomaghilamosnatatawapakainnoongpakpakgiyeracultivationnag-aabangipinagbabawalbowmeronhinipan-hipannagkakatipun-tiponcomplicatedprobablementeinternahilingartekabuntisaninvesting:malalimlimatiknauliniganmagturolasamay-arinakumbinsiiconicyamanhila-agawanmasilipkontingthroughoutrequirelegacykusinaamericapinagtagposponsorships,karwahengasialiv,companiesstocksloansnailigtasmangyariilalim1960sgaanotenamparobevareinterests,ipinanganakdalawangsocialebusiness:totoonaiiritangcandidatemajormarangalikinakagaliteveningsellingnangagsipagkantahanroselletransportationpanaynapilitangbelievedikinagagalaknagbababamananalokatabingwidenalangkalayuanmalumbayiiklinilalangbinibilangyearmanakboipagtimplainspirationdapit-haponnagawainsidentepagkakataonisawarililigawanfacenaglipanangtawaalaganagpapaigibtangandelepalaisipankablanmaibigaydemocraticvenusdiyancardspecializedlazadalike