Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

2. A couple of candles lit up the room and created a cozy atmosphere.

3. Spillene kan også være afhængige af held, dygtighed eller en kombination af begge dele.

4. Dumating na sila galing sa Australia.

5. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

6. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

7. Tumitigil lamang ito sa gabi upang makapagpahinga ang mga hayop upang sa susunod na araw ang may lakas sila upang ipatuloy ang pakikipaglaban.

8. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

9. Es importante trabajar juntos para abordar la pobreza y promover un mundo más justo y equitativo.

10. Kawah Ijen di Jawa Timur adalah tempat wisata populer untuk melihat api biru yang terlihat di dalam kawah gunung berapi.

11. The chef created a series of dishes, showcasing different flavors and textures.

12. Nasa kanluran ang Negros Occidental.

13. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

14. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

15. The scientist conducted a series of experiments to test her hypothesis.

16. Binulabog ng malakas na tunog ang katahimikan ng paligid.

17. Siya ang pinuno ng rebolusyonaryong kilusan laban sa pananakop ng mga Espanyol.

18. Natapos ko ang aking trabaho sa opisina sa hatinggabi dahil marami akong backlog.

19. He has been working on the computer for hours.

20. Mula sa tuktok ng bundok, natatanaw ko ang magandang tanawin ng kapatagan.

21. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

22. Alas tres ang alis ng tren tuwing hapon.

23. Ang pamilya ang sandigan sa oras ng kagipitan.

24. Huh? umiling ako, hindi ah.

25. I have graduated from college.

26.

27. ¿Puede hablar más despacio por favor?

28. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

29. A balanced and healthy diet can help prevent chronic diseases.

30. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

31. Ilan ang batang naglalaro sa labas?

32. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

33. Pagtataka ko kung bakit hindi mo pa rin napapansin ang aking mga ginagawa para sa iyo.

34. Sweet foods are often associated with desserts, such as cakes and pastries.

35. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

36. Nahanap niya ang nawawalang susi sa ilalim ng tarangkahan ng kotse.

37. Landet er et godt eksempel på, hvordan man kan skabe en velfungerende

38. The baby is sleeping in the crib.

39. Ang pagkakaroon ng masayang pamilya ay siyang ikinagagalak ni Maria araw-araw.

40. Ang sinabi ng Dakilang Lumikha ay natupad.

41. Wala kang pakelam! O sige its my turn na!

42. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

43. Los bebés pueden necesitar cuidados especiales después del nacimiento, como atención médica intensiva o apoyo para mantener la temperatura corporal.

44. Einstein was a member of the NAACP and spoke out against racism in the United States.

45. Ese comportamiento está llamando la atención.

46. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

47. At minamadali kong himayin itong bulak.

48. Umayos naman ako ng higa at yumakap patalikod sa kanya.

49. Nationalism has played a significant role in many historical events, including the two World Wars.

50. Nag-iisa kasing anak si Ranay.

Similar Words

following,

Recent Searches

followingnakakalasingbarrerasgumantimariemakitatuluyantelalaganapnagbungamagtatakanagbababakontinentengawaakalatungkolpitosumasayawentry:sinagotoftemariapanghihiyanglondoniiwasanpeacepagdukwangbiyernesnakaangatmakikipaglarobritishsigerabesahodganangparticipatingfencingmamariltumikimlagnatalas-diyesumagawpinasokbinanggatalambricosmonetizingpaglayasmagdaraospagapangikinuwentonapakamotnaibibigaydrinkspagguhitnami-misskaratulangmemorialfitnessmahalinpalancakanayangteacherwatawatuusapanmaidbulalasfysik,realisticnapasigawexperience,venuspasensiyakontraconclusion,pinahalatascottishnakahantadpinadalabansangpaghabaknownritamightiniirogpinakidalasteerpalayanlalargafertilizermakaratingcesmanilbihankalarolandstevekaliwangstyleeuropelumipadworkshopsearchmagpapaligoyligoyelenacultivovehiclesnagsinenakapagngangalitbobonamilipithigh-definitionmostpalakacountriesrealnatitiyakandamingnamumulaklakbutterflyourpresslumilipadbisitabopolsbinilhancigarettepanoqualityisapahiramochandonag-iisathoughnilinistaingabringmaatimprofoundnagwalisstagepumuntaauditmalikotumigtadshadesmakalingpang-aasarredigeringisamanagwo-workmakabawiexamplenagtatampocourseslayout,presidenteinteractbio-gas-developingnagcurvemakakawawatoolnapaiyaktigasnakitulogmakitangpantheontotootekabakagayunmanjobsrepresentativesagiladahilsetsleadingpinasalamatanlaamangpalapagyouthgutomdipangforcesintroducenariningcurtainsabrilworkdaynananalosumahodriserepresentedmuchhardlumalakadpakelamerolaki-lakipatawarinnutserap