Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. The scientific method is used to test and refine theories through experimentation.

2. Haha! I'd want to see you fall inlove tonight.

3. Las labradoras son muy activas y necesitan mucho ejercicio diario.

4. Ang bobo naman ito, di pa nasagutan ang tanong.

5. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

6. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

7. Walang pagtutol sa mga mata ng mga ito.

8. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

9. Me duele al tragar. (It hurts when I swallow.)

10. Akin na cellphone mo. paguutos nya.

11. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

12. Dahil sa pandidiri ay nilayuan niya ito pero ang pulubi ay humabol at nagmakaawa.

13. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

14. A caballo regalado no se le mira el dentado.

15. For you never shut your eye

16. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

17. She learns new recipes from her grandmother.

18. Ang mga natatanging kontribusyon ng mga siyentipiko sa kanilang larangan ay dapat na itinuring at ipinagmamalaki.

19. Ang bango ng kape sa umaga ay nagbibigay ng mabuting simula sa araw.

20. Ang paborito niyang laruan ay Beyblade.

21. Las escuelas también ofrecen programas de educación para adultos.

22. Ang mga batas tungkol sa paggamit ng droga ay mahalaga upang maiwasan ang mga krimen na may kinalaman sa droga.

23. Ang panaghoy ng mga pasyente ay naging panawagan para sa mas maayos na serbisyong pangkalusugan.

24. Nakakuha kana ba ng lisensya sa LTO?

25. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

26. Ilang kuwarto ho ang gusto niyo?

27. Hindi sadyang nagkaubusan ng pagkain sa aking ref.

28. Honesty is the best policy.

29. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

30. Today, Presley is widely considered to be one of the most important figures in American music and culture

31. Supporting policies that promote environmental protection can help create a more sustainable future.

32. Bumili sila ng bagong laptop.

33. Eh bakit hindi ka muna kasi bumili ng makakain mo?

34. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

35. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

36. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

37. Gusting-gusto ng kanyang magtatapos na anak ang minatamis na garbansos.

38. The blades of scissors are typically made of stainless steel or other durable materials.

39. Ang ganda naman nya, sana-all!

40. Gusto ko na po mamanhikan bukas.

41. Naniniwala ka ba sa legend ng academy?

42. "Dog is man's best friend."

43. Sa aming pagsasaliksik, nagkaroon kami ng maraming mungkahi upang mapabuti ang aming eksperimento.

44. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

45. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

46. Napatungo ako dahil nangingilid na naman ang mata ko.

47. Tinaas ko yung isang kilay ko, I'm working for him noh.

48. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

49. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

50. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

Similar Words

following,

Recent Searches

eroplanofollowingsaktanumokaypumikitisinalaysaynilayuansiguropanatagbiyerneskauntiretirarsikatsarongsinghalhumihingitinanggalpapalapittandangkinakainnasunogkamalianhappenedpaggawanapadaankaybilisnakabiladlabahinbibilhinnapasukoisipanalletinapaygigisinggulangmaniladustpannayonasiapagkaingcocktailagam-agaminfluenceskasoymakulitpublicitymonumentoparehaswednesdaymatitigaspagkattotoogayunpamanandoysisterpusatinitindakulotinimbitaanihinpresleyiskedyularkilaiconsmustcinesentencemanghuliyarieclipxepatunayankumukulobayanwatchingpinalutonagdaramdamumingithulikomunikasyonabahumanosequenalalamanpunsotonightipinadalacapitaltransmitslingidpulubilaryngitishmmmmandamingreadersbernardodollyginangsuffertuwangmanghikayatbokmapahamaktendermaalogboksingsilaybalingmalagobosespagkamanghaauthorlakaspdailawbinabakinamumuhianconditionyumakapparisilid-aralanpasinghalnangumbidapulapocapasanpwestoprosperexitexistcharmingmuchasabenecafeteriamarchalingdolyaripinabalikaalisnagwagibasapinaspendingtirahanpangalanchunbaleheydaanhundredreferslackpookfloortextoataquesaddresscoachingproducirbilerkamotemississippipaskongcleanplatformskasinggandaenforcingredhouseholduniqueelectedventaaggressionnegativecornercheckscomputerhighestgeneratedlearnamazonsumugodnakapapasongsapagkattv-showsnaiinistoolstinikpalakolsinabimarangyanghistoryraisednenapagputisinasabimarinigiba-ibangmakikipag-duetotapatnasasakupan