Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Einstein's work led to the development of technologies such as nuclear power and GPS.

2. Lumabas na rin naman ako pagkatapos.

3. Boboto ka ba sa darating na eleksyon?

4. Napakalakas ng bagyong tumama sa kanilang bayan.

5. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

6. Pull yourself together and stop making excuses for your behavior.

7. El teatro experimental presenta una interpretación sublime del teatro moderno.

8. Dahan dahan kaming nag lakad. Papapunta sa may.. Sigh.

9. Sa droga, hindi ka lamang nanganganib sa iyong kalusugan, kundi pati na rin sa iyong kaligtasan.

10. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

11. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

12. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

13. Tanggapin mo na lang ang katotohanan.

14. The wedding reception is a celebration that usually follows the wedding ceremony.

15. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

16. Likas na mabait si Perla pasensiya na lamang ang kaniyang binibigay sa kapatid na si Amparo na ubod na tamad.

17. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

18. They launched the project despite knowing how risky it was due to time constraints.

19. Gusto ko na umuwi ng Pilipinas.

20. Baka puwedeng hiramin mo ang iyong sasakyan para sa isang biyahe.

21.

22. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

23. Isang araw, naabutan ni Nicolas si Helena sa palasyo.

24. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

25. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

26. Emphasis can be used to persuade and influence others.

27. Magkano ang isang kilong bigas?

28. Ang pangalan ni Carlos Yulo ay patuloy na magiging simbolo ng tagumpay ng atletang Pilipino.

29. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

30. Naguusap na tayo. Narining ko siyang nag sigh

31. Ang laki ng sawa na kanyang nakita.

32. Lumampas ka sa dalawang stoplight.

33. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

34. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

35. Hindi malinis ang mga tsinelas ni Lori.

36. The pretty lady in the movie stole the protagonist's heart.

37. Sa daan pa lamang, bago siya pumasok ng tarangkahan, ay natatanaw na niya ang kanyang anak na dalaga na nakapamintana sa kanilang barung-barong.

38. She has run a marathon.

39. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

40. Bakit umiiling ka na naman? May problema ka ba?

41. Oh gosh, you're such an ambisyosang frog!

42. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

43. Anong kubyertos ang hiningi ni Maria?

44. Nakaupo sa balkonahe, pinagmamasdan niya ang mga tao na dumaraan sa kalsada.

45. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

46. Paano po kayo naapektuhan nito?

47. The website's design is sleek and modern, making it visually appealing to users.

48. Sino pa, isisingit ni Ogor, di si Dikyam!

49. Ipinagmamalaki ko ang pagiging Pinoy dahil sa mayamang kasaysayan ng ating bansa.

50. Paano ho ako pupunta sa palengke?

Similar Words

following,

Recent Searches

valedictoriannamilipitfollowingkastilacramenaantigvictoriainhalegovernorsgarbansosbusiness:libertyasukalmabigyantalinoininomnaghubadpaliparinnatutulogliligawanonlinebisikletaidiomamagdaannandiyangasmenpayongkatolikopatongestilostagaroontsssproductspamamahingalinteksmileganitoupuannasantamapamimilhingalasincidencelilytibigkasangkapanulamyourbinatakibinentarestaurantmayamanpuwedeaffiliateyourself,psssbestaudiencebilaoinomstruggledbumabahanitobumabagbusiness,tonightdettemenoscitizennagbasadalawahousepatisumapitneropupuntasincekingbinigaymesangtenpdapersonsoverviewmulti-billiondidingnaroonateitimmessageclientestiyaipongfaraidmind:inilingwayssyncpacegitnathirdclassmateblessshouldfirstproduktivitetniyangnapag-alamanmakasahodfacemaskanaytinderamagpasalamatlendinglumipadpoliticsmanggagalingkalyefeelingfuellabingbuwaldingdingbagsakmeriendaetocomunesiniinompagdukwangshowlibrodatapwatmaunawaanmaingaylordkaramisummitnamuhayandrespowerssumamagasolinatumalimkidkiranmagbibigaynagsmiletumahanpagkaraanaglokosundhedspleje,mashanap-buhaymangkukulampresidentehayaannalalabingtumakaspagdudugoprovepresence,nabighaninakikitangpinagmamalakipagka-maktoldi-kawasarecibirginagawapostcardparinnyadahonkinauupuaninferioresnalalaglagnaglipanangnagsunurannanlilimahidlumalangoykinatatakutanprimerosmakikipag-duetopamilihaneditnagpagupitkare-kareuusapanmakasilongpaghihingalohinimas-himasentrancepaumanhinmagpagalinghawaiimagtakamamalasamericana-fundjuegospaghalik