Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. He has visited his grandparents twice this year.

2.

3. Ang pagkakaroon ng tamang kaalaman at kakayahan ay makakatulong upang maibsan ang pangamba.

4. This shows how dangerous the habit of smoking cigarettes is

5. The store was closed, and therefore we had to come back later.

6. Natural language processing is a field of AI that focuses on enabling machines to understand and interpret human language.

7. Nakagawian na ng prinsesang mamitas at mamasyal sa tila bang perpekting hardin para lamang sa isang prinsesang katulad niya.

8. Good afternoon po. bati ko sa Mommy ni Maico.

9. Duon nakatira ang isang matandang babae at ang kanyang apo, isang binatilyo.

10. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

11. Ang mga bayani ay mga taong nagsakripisyo para sa kalayaan at kabutihan ng bayan.

12. Anong ginagawa mo?! mataray pang sabi nito.

13. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

14. Hinahangaan siya ng marami dahil sa kanyang pagiging mapagkumbaba kahit galing siya sa mababa na estado ng buhay.

15. Magdamagan ang trabaho nila sa call center.

16. Les banques jouent un rôle clé dans la gestion de l'argent.

17. In the land of Narnia, four siblings named Peter, Susan, Edmund, and Lucy discover a magical wardrobe.

18. Kings have held power throughout human history, from ancient civilizations to modern times.

19. Other parts of the world like Burma and Cuba also cultivated tobacco

20. Sa langkay na iyon ay kilalang-kilala niya ang anyo ni Ogor.

21. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

22. Some viruses, such as bacteriophages, can be used to treat bacterial infections.

23. Tengo una labradora negra llamada Luna que es muy juguetona.

24. Ang itim mo, Impen! itutukso nito.

25. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

26. Nami-miss ko na ang Pilipinas.

27. Sumakit ang tiyan ko kagabi kaya ako ay biglaang nagka-sick leave.

28. Walang huling biyahe sa mangingibig

29. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

30. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

31. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

32. The guilty verdict was handed down to the culprit in the embezzlement trial.

33. Nakita niyang lumalakad palayo ang kaibigan, na tila may tinatago.

34. Sebagai bagian dari perayaan kelahiran, orang Indonesia sering mengadakan acara syukuran atau kenduri.

35. There's no place like home.

36. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

37. Alam ko ang kabutihan ng iyong kalooban.

38. Ibinigay ng aking guro ang kanyang oras at dedikasyon upang masiguro ang aming matagumpay na pagkatuto.

39. Aller Anfang ist schwer.

40. Nakasandig ang ulo sa tagpiang dingding.

41. Hinawakan ko na lang yung pisngi niya. Matulog na tayo.

42. Paano mo pinalambot ang giniling na karne?

43. Sa mga gubat ng Mindanao, may mga punong-kahoy na may napakalaking kahoy at tinatawag itong "Lauan".

44. Sa mga huling taon, yumabong ang turismo sa lugar na ito dahil sa mga magagandang tanawin.

45. Goodevening sir, may I take your order now?

46. Nagsilabasan ang mga taong bayan.

47. A couple of songs from the 80s played on the radio.

48. Saan naman? nagtatakang tanong ko.

49. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

50. Hindi kailanman matatawag na hampaslupa ang mga taong mahihirap ngunit nagta-trabaho ng marangal.

Similar Words

following,

Recent Searches

following1970spakistandecreasedreorganizingpinapakingganxviinasagutantumalonstorypoongpagtatakavaccineskinalakihansabihininakalamagbibiladlabinsiyamlumitawkaraokepaumanhinlibertytienenlagnatlumagoempresastandangpagbebentamahuhulimaabutannasaangtilganggusting-gustokulisapkamotetagaldiliginkumapitpakaininalagamaghapongydelserkanyainspirehiwagapatunayankatagakasaysayanpasensyalumilingonitutuksoumalisalassusimatapangstocksnagkasunogtumingalaxixpulubimerryprincetonightsupilinresumengamitinhitikkinainpogiplaysspaaddresscountriesnaritoditosparkadditionmuchasaudio-visuallyamongnuonhamakchavitbumababaspeechescommunitymisusedsinunoddettehearbarnespinakinggancasesdumalomagbubungadoscrazysofapowersaidumilingpagtangisworkdayheibumabaideaulingleadprocessrefshiftelectnutsplatforminfluencefroggawaingtiyakfluidityinspiredhumahangoskommunikereractualidaddecisionshorsemalambotuuwipaghuhugassizelilipadwestmayakaptinapaytataaspaanopisarabasaairconomfattendenagbagokaawayasahansumuotmapahamaksystemsinampalnilulonbarung-barongfionaespadapapuntaproyektotumamahahahanaglokohannatuwaharapanmaghapontrabahocruzbumaligtadmadungisipinatawagsay,needsclassesamazonhellobroadcastingtworegularmenteblessmotionhapdionlycouldcleantawaikinamataynag-iyakannagsusulatnakagalawsundhedspleje,nagmamaktolkumukuhanakaliliyongpalipat-lipatnapapasayamatapobrengnapaiyakdahan-dahanalikabukintravelerpagsumamoeconomygayunmannamulatespecializadasnagpipikniknag-aalalang