Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. The relationship between work and mental health is complex and can vary from person to person.

2. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

3. Ano ang kulay ng notebook mo?

4. All these years, I have been creating memories that will last a lifetime.

5. Aba'y lintek na babaeng ito! Ang langis mo! Paano na ako magugustuhan ni Pedro nyan! ani ni Ipong sabay hawi ng buhok.

6. Oscilloscopes can capture and store waveforms for further analysis and comparison.

7. Ang tubig-ulan ay nagbibigay ng mga oportunidad para sa mga aktibidad tulad ng paglalaro sa ulan, pagsusurfing, at iba pa.

8. Marmaing sandaling walang nangahas magsalita.

9. Malaki ang lungsod ng Makati.

10. Mathematics can be used to model real-world situations and make predictions.

11. Ang paggawa ng sining tulad ng pagpipinta o pagguhit ay isang nakagagamot na paraan upang maipahayag ang aking damdamin.

12. Nalungkot ang Buto nang dumilim na ang paligid.

13. Ang hina ng signal ng wifi.

14. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

15. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

16. Ang kanilang anak ay tinawag nilang Amba.

17. Kumakain ng tanghalian sa restawran

18. Knowledge is power.

19. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

20. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

21.

22. Laking pagkamangha ni Aling Rosa ng makita ang anyo ng bunga nito.

23. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

24. Napakahusay na doktor ni Jose Rizal.

25. Membuka tabir untuk umum.

26. La creatividad puede ayudar a solucionar problemas de manera más efectiva.

27. Binansagang "Gymnastics Prodigy" si Carlos Yulo dahil sa kanyang talento at husay.

28. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

29. En el siglo XIX, el Romanticismo español tuvo un gran impacto en la música, con compositores como Isaac Albéniz y Manuel de Falla

30. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

31. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

32. El arte puede ser utilizado para fines políticos o sociales.

33. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

34. Wala yun. Siya naman talaga ang may kasalanan eh.

35. Bakit ka nakitulog sa bahay ng kaibigan mo?

36. Hindi ako masyadong mahilig sa pagpupuyat sa hatinggabi dahil masama ito sa kalusugan.

37. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

38. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

39. LeBron James is a dominant force in the NBA and has won multiple championships.

40. Ang taong na-suway sa kautusan ay maaaring pagmultahin o parusahan.

41. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

42. Pumunta si Trina sa New York sa Abril.

43. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

44. Tanging si Kablan ang may tindahan sa kanilang komunidad.

45. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

46. Ngunit lumakas ang agos ng ilog, at napailalim sa tubig ang mag-aama.

47. Practice makes perfect.

48. La poesía de Whitman tiene una belleza sublime que transmite su amor por la naturaleza.

49. Ayaw niya ng maarte at mataas na presyo kaya lagi siyang nagbabakasakali sa mga mababang halaga.

50. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa mga tao sa paligid natin.

Similar Words

following,

Recent Searches

kabighaattorneypabilihinamakmabigyanmakakafollowinglabisinstrumentalmaaaringnovellessarongkutsaritangsementoasahanmassachusettsipinambiligawajolibeetaksimaaksidentetirangestadossampungbaldesumusunodexcitedbinatilyohabitasiahumpayhinintaytagaknamannahulognaminpangakosumasaliwinstitucionesumibiglaamangnaisathenasapottasalipathelpedtulalasalbahehoytulangmatitigassikipinintaylunesnagdarasalpriesttwo-partynuhhverparkehumblemedyomaaarisignkulaykarapataninihandakahilingannabigyanmamanugangingipaliwanagsang-ayontoybinanggakontingsitawenergingitirisesalatmissionpusavivainvitationmalagotokyonagisingtusindvisyouthlunetamaalogwikaconclusiontradedipangitinagobilugangsuccessmaarispareinulitsinimulanhdtvsamakatwidcitizentiketindianaglinisseekmagpuntasumasambatingbalingherunderexcuseestarspentmagdaroombatotonightadversetinangkamalabogreenlineagospedeballleechoiceadverselybirojackyhallcompartenlabananagebringdinalaartificialboseskarnabalteamroleincreasinglyhoweverlayuninfistssumapitmasaganangprosesoikinakagalitmatangkaddiyantipeditrequireintelligencebehaviorelectedhalossmallcableshouldcharitableflyeasyboxslavenitongpootbirthdaypaligsahanteachmuligttaaspananakitnagtitindamatandang-matandainilingtuwamalashindesino-sinonagbiyayabangosnaghihinagpisbagkus,punopapasokmakahihigitlinggongtsonggodyipkangkongolivapumuntapasko