Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

2. The sound of the waves crashing against the shore put me in a state of euphoria.

3. Some people view money as a measure of success and achievement, while others prioritize other values.

4. We need to address the elephant in the room and discuss the budget issues.

5. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

6. Napaluha si Aling Pising nang makita niya ang bunga nito.

7. Uminom siya ng maraming tubig upang iwasan ang bungang-araw.

8. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

9. Kung hindi siya maramot, baka mas marami ang natulungan niya.

10. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

11. Habang kaming mga naiwan ay paglalabanan at pag-aaralang tanggapin ang kirot ng pagkalungkot.

12. May mahalagang aral o mensahe na ipinakilala sa kabanata, naglalayong magbigay ng kahulugan at kabuluhan sa kwento.

13. Umiling siya at umakbay sa akin.

14. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

15. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

16. Las plantas medicinales se utilizan para elaborar remedios naturales y tratamientos terapéuticos.

17. Sa sobrang pagpapatubo sa perang ipinauutang, galit na galit ang mga mangingisdang hindi makapalag sa kaswapangan ng kanilang kababayan.

18. Halos wala na itong makain dahil sa lockdown.

19. Su obra más famosa es la escultura del David en Florencia.

20. There's no place like home.

21. Aalis siya sa makalawa ng umaga.

22. La armonía entre los instrumentos en la música de Beethoven es sublime.

23. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

24. Tinulungan ko siyang dalhin yung mga plato sa dining room.

25. Inakalang imposible ang kanyang pangarap, pero naabot niya ito.

26. Sa mapa, makikita mo ang mga pook na may magandang tanawin.

27. La música puede ser una forma de protesta y expresión de descontento.

28. Pumasok po sa restawran ang tatlong lalaki.

29. Some dog breeds are better suited for certain lifestyles and living environments.

30. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

31. Nagulat ako nang biglaan siyang tumawag at nangumusta sa akin.

32. Les étudiants peuvent poursuivre des études supérieures après l'obtention de leur diplôme.

33. The policeman directed the flow of traffic during the parade.

34. Ate Annika! Gusto ko yung toy! Gusto ko yung toy!

35. The king's legacy may be celebrated through statues, monuments, or other memorials.

36. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

37. Amazon has a vast customer base, with millions of customers worldwide.

38. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

39. She has been working on her art project for weeks.

40. Después de la reunión, tengo una cita con mi dentista.

41. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

42. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

43. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

44. Malamang na tamaan ka pa ng kidlat.

45. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

46. A couple of lovebirds were seen walking hand-in-hand in the park.

47. I am not watching TV at the moment.

48. All these years, I have been discovering who I am and who I want to be.

49. Más sabe el diablo por viejo que por diablo. - Age and experience trump youth and cleverness.

50. She does not procrastinate her work.

Similar Words

following,

Recent Searches

iyamotpananakitlibertyfollowingtaksinagtatakangsarilingschedulemanypinunitinfluentialauditnaturalschoolgetpigilanbreakpreviouslydospublishingfascinatingtvsoffentligeditflynegativeonlysubalitelecttinataluntonkirotmethodsedit:dedicationcallingmasteradoptedganaplabahinbayangindependentlymaubosbibilibumagsakvariedadpuntakaibigankatibayangmagisingsanglihimbutihingkondisyoncocktailayawlasaquarantinedadalonandiyanbagamalivenamofficepracticadoknowsaywansukatlumulusobmaskihojascorporationbinawianhinukaymariloubenefitsgatolretirartraditionalawaubodconsistcarediamondipaliwanagdeterioratepagkakatayomenutiyacirclehimighulingstatingroquedreamsstrategiesnakangisidoble-karapakikipagbabagwalkie-talkiemakapangyarihanpare-parehonakikini-kinitakatagalnapakagagandakahirapanmagbayadmagkakailapinakamatabangrevolucionadopinakamahabakinalakihansumusulatpagsagotmagdamagani-rechargematagpuanmagbantayskyldessummerejecutanpumayagmauuponatinaginilistakumirotpuntahanunantalinopagpalitsementongnabasabinitiwanmagalitsumalasaidnahulogencuestasyeywednesdayangelamaliitmonumentoroselleindividualslumahokbulaklakbilibangalbateryahappenedpasigawbumotojoseaudiencesoccerbumabahamayabangbilaocombinedkapatidgovernmentmagtiispatakastumubongtinawagkartongmakapaniwalaenchantedstringpaanerofansyanelectionheynakasakitmagkasakitrobinhooddumatingartificialeyeseenourstrengthpwestokilongnag-umpisamananaogfuncionesskabebestidobintanauulaminmahahabakaugnayanbabecoursestotoocleanulan