Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Bawal magpaputok sa kalsada dahil ito ay nakakabahala sa kapayapaan ng mga tao.

2. Gumagalaw-galaw ang sabog na labi ni Ogor.

3. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

4. Ang bayanihan ay nagpapalakas ng samahan at pagkakaisa sa aming pamayanan.

5. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

6. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

7. El claroscuro es una técnica que utiliza contrastes entre luces y sombras para crear efectos tridimensionales en la pintura.

8. Malaya na ang ibon sa hawla.

9. ¿Te gusta el sabor picante del jengibre?

10. La falta de acceso a tierras y recursos puede ser un desafío para los agricultores en algunas regiones.

11. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

12. Nasisilaw siya sa araw.

13. Ang mga himig ng kundiman ay nagpapalaganap ng mga kuwento ng pag-ibig na hindi matutumbasan ng anumang kayamanan.

14. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

15. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

16. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

17. Bilang isang Kristiyano, nagbibigay ng kahalagahan sa aking buhay ang mga awiting Bukas Palad.

18. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

19. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

20. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

21. Gracias por ser una inspiración para mí.

22. Lumampas ka sa dalawang stoplight.

23. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

24. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

25. Ini sangat enak! - This is very delicious!

26. Sa dapit-hapon, masarap magbasa ng libro habang nakatambay sa balcony.

27. Nanalo siya ng award noong 2001.

28.

29. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

30. La realidad es que las cosas no siempre salen como uno espera.

31. No dejes para mañana lo que puedas hacer hoy.

32. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

33. Sang-ayon ako na dapat natin pagtuunan ng pansin ang kalagayan ng ating kalikasan.

34. Ganid na sa pera ang mga taong nakaupo sa pwesto.

35. Mabuti naman at nakarating na kayo.

36. Nagtatrabaho ako sa Student Center.

37. Politics in America refers to the political system and processes that take place in the United States of America

38. Ang pagkakaroon ng karamay at suporta mula sa mga mahal sa buhay ay makatutulong upang malunasan ang pangamba.

39. Hinde ka namin maintindihan.

40. Cheating is a personal decision and can be influenced by cultural, societal, and personal factors.

41. Magkita na lang tayo sa library.

42. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

43. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

44. Siya ay nagpunta sa simbahan, lumuhod, at nagdasal.

45. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

46. Mahigpit namang ikinabit ng mga halaman ang mga ugat sa ilalim ng lupa.

47. Inalagaan niyang mabuti hanggang sa ito'y magbunga.

48. Last full show tayo. Ano bang pinakamalapit na mall?

49. Sa iyong pagdating, lumiwanag ang aking mundo.

50. Hindi pinakinggan ng Ada ang abuhing Buto ng Kasoy.

Similar Words

following,

Recent Searches

pasahekinakainmbricosfollowingmangingisdangpasasalamatlalakadpagkamulatmasayadoslugawunconventionalninaturonmataaasmamarilparaangiikotmakausapdomingosumisidpagdamisellingsumimangotinventadomatitigaspakisabipaketeasiapaladbernardonag-aabangstep-by-stepadoptedaudiencepalagimarangyangbritishrenatomagtipidvistexhaustedbinanggakabutihansinapaklinggomahahaba11pmguhitamparoniligawanpaghingiwereipapaputolmagbalikkanangjackzbinibinikatabingritwalbumahalargerzoombinigyangpropensotaposkararatingbuwalspendingnathanngpuntadrewluisideassumakittenpandidiriplancallsutilshapinglastinglibrelcdpracticadochambersinterpretingtamisnakuhamemorygawingwhethercleanmarkedeachandrepilingedit:librobreakkaraokeochandopagpasoknakagalawtangeksakomagdamagawitannagpalutokinapaakyattuloy-tuloyrightsctricasbighaniamendmentsadditionally,revolucionadocorrectingomfattendekitanaglabananmembersaccederlegislationitinalagangrinnagdadasalagabipolarsalamatstatingkilonag-iisabiliskondisyonslavenagtalagabisitaugalitinignansapatmaranasanplagassampungkikilosbeerexitjustmakatulongnapalingonhomeworkfacebookfilipinokilalaanghelnalulungkotposporodistansyanakapamintanapagka-maktoladvertising,magtatagalpagkakapagsalitanakakapagpatibaysolidifyworkdaysariwanagpalalimmatapobrengnakayukomasayahinnakaka-innakakagalingnalalamanmangangahoynagsasagotnakapapasongnagmungkahibakitinalagaantitamalapalasyopangangatawantumatanglawnaiyakpinag-aaralancrucialmedisinapinagbigyanmumuntingflyvemaskinermakapalagpagtatanimmagkasamatinawagkaklasemagtatanimmagpapigilmensahe