Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

2. Musk has been described as a visionary and a disruptor in the business world.

3. Makikiligo siya sa shower room ng gym.

4. Maaga dumating ang flight namin.

5. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

6. Television has a long history, with the first television broadcasts dating back to the 1920s

7. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

8. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

9. Napakabuti nyang kaibigan.

10. Nagitla ako nang biglang bumagsak ang mga plato sa kusina.

11. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

12. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

13. Me encanta pasar tiempo con mis amigos jugando al fútbol.

14. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

15. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

16. Panahon na lang ang hahatol kung nararapat na ngang ibalik sa dating anyo si Kiko.

17. Napaluhod ang datu kasama ng kawal.

18. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

19. Tumango siya at nagsimula nang kumaen.

20. Mayroon ba kayo na mas malaking size?

21. Matayog ang lipad ng saranggola ni Pepe.

22. Kapag bukas palad ka, mas maraming taong magmamahal at magtitiwala sa iyo.

23. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

24. Aku rindu padamu. - I miss you.

25. Las personas pobres son más vulnerables a la violencia y la delincuencia.

26. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

27. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

28. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

29. Ang panaghoy ng mga hayop sa gubat ay bunga ng pagkawasak ng kanilang tirahan.

30. Ako ngayo'y lumilipad at nasa langit na.

31. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

32. Ang sabi nya inaantay nya daw girlfriend nya! Ang sweet!

33. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

34. I know you're going through a tough time, but just hang in there - you're not alone.

35. I am planning my vacation.

36. Saka na yun, pag fiance ko na sya saka ko sya liligawan!

37. Bukas ay magpapabunot na ako ng ngipin.

38. Si te gusta la comida picante, prueba el guacamole con jalapeño.

39. Sino ang doktor ni Tita Beth?

40. Sa takip-silim, mas maganda ang kulay ng langit dahil sa kakaibang mga kulay.

41. Maaliwalas ang simoy ng hangin sa probinsya.

42. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

43. Me duele el estómago. (My stomach hurts.)

44. Inflation kann auch durch externe Faktoren wie Naturkatastrophen verursacht werden.

45. La obra de arte abstracto en la galería tiene una belleza sublime que despierta la imaginación.

46. Napuyat ako kakapanood ng netflix.

47. He is taking a walk in the park.

48. Muchas serpientes venenosas poseen colmillos huecos a través de los cuales inyectan veneno en sus presas.

49. Sa kanyang paglalakad, napadungaw siya sa isang tindahan ng kakanin at napabili ng puto.

50. Nanalo siya ng Palanca Award para sa panitikan

Similar Words

following,

Recent Searches

favortaksifollowingnaawaxviikalarotalinotiempostumindigcaracterizanawalapigilannakisakayliligawandespueslasakunwalihimtasapakisabibutigrowthmisteryonandiyanalmacenarforskelmagsaingpalapagsisipaincandidatespakaininnilalangpulongabutannayonmakapalexcusediagnosticremaintonightcitizenspinatidbiluganghojasneagrinsagadsnamrswaripangittradebilaoskypeinominiinomsinkisippalamutihoundalasasiaticpangilsacrificekamustatiniktsuperkahusayanjuanpalakadesarrollarreviewpiratalaruanmangingibigpinalayasmataasfiverrwinsmatitigaspaldakalawakanlabingsoonmeetdatapwatnyeprobablementechoicesumubofridaykunetingbook:dilimwatchingspeechesveryumalisipanlinismakulitplacenahulimagnifyreserveskamicivilizationmestbornheialefistsellendoingstudentearninalisauditcableknowsidoduranteconsidernag-aralnotebookimprovedcirclenarining2001safetiyaseenbabemobilebaldecommunicationdiretsomaicomagpapigilpinakamagalinglindolshocknatitiraresignationbroadcastslegendskandoymultogenerabareallycomunicarseentryrefcuandoareafallulingaddingmethodskabighadrawingmakipagkaibiganexigentemababangissilangpiyanoinspirationmaibigaysusinunomaibanaglababinabaratplantarberetikabilangmaghatinggabisaringinyongjackzkahuluganinalagaanagenagsunuranadditionally,hallpinahalatatrackinsektongnalalabihumiwalaypartiesnanaisinnasasakupannakatunghaypaglisannakalilipasnagwalisde-lataliv,