Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Mange transkønnede personer oplever at blive udsat for chikane, mobning og vold på grund af deres kønsidentitet.

2. Nasa iyo ang kapasyahan.

3. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

4. Hindi siya maarte sa kanyang damit, ngunit sa kanyang mga aksyon ay makikita mo ang kanyang kahalagahan.

5. Don't count your chickens before they hatch

6. Napakatagal sa kanya ang pagkapuno ng mga balde ni ogor.

7. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

8. Ang mailap na kapalaran ay kailangan tanggapin at harapin ng may lakas ng loob.

9. Les personnes endettées peuvent se retrouver dans une situation financière difficile.

10. Malaya na ang ibon sa hawla.

11. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

12. Ang kaniyang ngiti ay animo'y nagbibigay-liwanag sa madilim na kwarto.

13. May gusto ka bang gawin mamayang gabi?

14.

15. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

16. Malungkot ang lahat ng tao rito.

17. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

18. May klase ako tuwing Lunes ng hapon.

19. Translation: I cannot change the past, I can only accept it with "what will be, will be."

20. Fødslen kan være en fysisk og følelsesmæssig udfordring for både mor og far.

21. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

22. Nakatulog ako sa harap ng telebisyon at nagitla ako nang biglang nagtaas ang boses ng mga artista sa palabas.

23. Ang bawat isa ay may bahagi sa pagpapabuti ng bayan.

24. Sa kanyang masamang gawain, nai-record ng CCTV kung paano siya na-suway sa patakaran ng paaralan.

25. I got a new watch as a birthday present from my parents.

26. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

27. Matagal akong nag stay sa library.

28. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

29. No puedo dejar de dar las gracias por todo lo que has hecho por mí.

30. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

31. They organized a marathon, with all proceeds going to charitable causes.

32. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

33. "The better I get to know men, the more I find myself loving dogs."

34. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

35. Bumili si Ana ng regalo para sa asawa.

36. Noon di'y nangalaglag ang lahat ng mga bunga ng punong-kahoy at natabunan ang katawan ni Sangkalan.

37. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

38. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

39. Ano ang tunay niyang pangalan?

40. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

41. Dedication is the driving force behind artists who spend countless hours honing their craft.

42. Libre ba si Renato sa Huwebes ng gabi?

43. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

44. Tumakbo na ako para mahabol ko si Athena.

45. Ibig niyang maranasan ang mga bagay na kaiba sa kinalakihan.

46. En mi jardín, cultivo varias hierbas como el tomillo, la albahaca y el perejil.

47. Hindi mo malalaman na maarte siya sa kanyang kagamitan dahil lagi itong malinis at maayos.

48. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

49. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

50. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

Similar Words

following,

Recent Searches

followinghinamakkamalianiniiroggubatpneumonianatakotpinisiltaksipanunuksovitaminnasundoservicesbibilhinagostonababalotkanilamassachusettsiniangatpangyayarigabiipinamilihumpaykutsilyorepublicanibilinaritoiiyakempresasnakamitkarapatanmarahaskalongmobilitytagaroonkirotsabogmatitigasorasankaninahuwebesmaaarihugisbumabagmarmaingkananlockdownkantakaintonight1929syapabalangresortgreatlykuwintaspinapaloleadersnoongpearlforeverboxmaisusuotkunemagkasakitmabiliskamatiscitizenscaredogyesmeetbiromatchingstarumagawkundisakimpinansinbornmatindifinddenunoiconbilerimaginationcontentinyopotentialprovidedroqueoftetakebalitaanak-pawispuedeimposiblepiecestransmitidaskitapumikitprogramming,kasingfallconditionnaghihirapkahitnagtagaltumamahinalegendaryginamitpaglisanmabutinghinintaymarahilmindtayosinimulanharimangfaktorer,laylaykuwadernosiyaatinitinalibirthdayhatinggabiinfusionesteachbagkusmaghahandanaramdamsamakatwiddisplacementmagandabiyaknegosyodevelopmentkidkirankastilaayontwinklejeromenanditoapoyrosaspag-aaralangautomatiserenagmaisipmaliitaccedergumawanangrosagawaingbookrumaragasangkukuhanalalabingscaleblogmoodpagtutoleconomicsasayawinmajorgoneseriouscamerabaosilyahimrelativelydarkvasqueseducationalchamberseveningschedulepanimbangmahihirapaminnaibibigayestudyantenakasandigsiniyasatlabing-siyamtatlumpungdisenyongpagsasalitapalabuy-laboymagasawangfilmnakapangasawanakaramdamnamumulaklak