Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Ano ang suot ng mga estudyante?

2. Lagi nating isipin na ang mga pagsubok sa buhay ay hindi dapat maging hadlang upang maipagpatuloy ang ating buhay.

3. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

4. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

5. Nagdadasal ang mga residente para sa ulan upang matapos na ang tagtuyot.

6. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

7. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

8. Pull yourself together and focus on the task at hand.

9. Sa pangkat na iyon ay kay Ogor agad natutok ang kanyang tingin.

10. Don't count your chickens before they hatch

11. Umikot ka sa Quezon Memorial Circle.

12. Emphasis can be used to express emotion and convey meaning.

13. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

14. The damage done to the environment by human activity is immeasurable.

15. Ako si Rodona ang diwata ng budok na ito.

16. Fathers can be strong role models, providing guidance and support to their children.

17. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

18. A couple of phone calls and emails later, I finally got the information I needed.

19. Ipaghugas mo siya ng mga Maghugas ka ng mga

20. Nangahas si Pedro na magnegosyo kahit walang sapat na puhunan.

21. Pinagmasdan ko sya habang natutulog, mukha syang anghel...

22. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

23. They analyzed web traffic patterns to improve the site's user experience.

24. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

25. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

26. Børns mentale sundhed er lige så vigtig som deres fysiske sundhed.

27. Sumuway sya sa ilang alituntunin ng paaralan.

28. Knowledge is power.

29. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

30. Kakain ako sa kapeterya mamayang tanghali.

31. Lumaking masayahin si Rabona.

32. Les patients peuvent être autorisés à quitter l'hôpital une fois leur état de santé stabilisé.

33. Kung wala kang maayos na balak, huwag kang umasa sa magandang resulta.

34. Nakain na nito ang lasong bunga at unti-unti na itong nangingisay at bumubula ang bibig.

35. The store was closed, and therefore we had to come back later.

36. Paki-translate ito sa English.

37. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

38. La tos productiva es una tos que produce esputo o flema.

39. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

40. Sa pagsasaayos ng paaralan, ang bayanihan ng mga guro at magulang ay nagdulot ng magandang resulta.

41. Gusto mong mapansin sa trabaho? Kung gayon, ipakita mo ang iyong husay at sipag.

42. Nagluto ng pansit ang nanay niya.

43. Humahanga at lihim namang umiibig ang maraming kabinataan sa tatlong dalaga.

44. Dahil matamis ang dilaw na mangga.

45. Ang hardin ng aking lola ay mayabong na puno ng mga bulaklak.

46. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

47. Habang naglalaba, napadungaw siya sa labas at napansin ang magandang paglubog ng araw.

48. Isang beses naman ay ang sandok ang hinahanap.

49. Ang mga salaysay tungkol sa buhay at mga gawain ni Rizal ay naging paksa ng mga akademikong pag-aaral at pagsasaliksik.

50. Saan-saan kayo pumunta noong summer?

Similar Words

following,

Recent Searches

followingsandwichmaynilatalagangtamarawnagtaposkailanmankumaenbasketballnabiglatirangmabibinginauntogmisyunerongisinaranahigaganangbisikletaasiamariecalidadkayomagsimulabanlagnapanapagodkahittuloyfatherumalistrabahomatigasbinanggalayawsinagotkulotcarrieslinggosusulitchambersbecamepetsangibonlintagraphicattractivetapelongmahiwagaitutolincreasinglymapapansinnilutolahathariadddahonsamathirdrepresentativenapapatungonakatirangpagkakayakaphandaantumatawagcarmenkumakainadvancepinagkakaabalahanyearnaupopayapangtumingalavidtstraktsasayawinmarketplacespesoapatnapukakutisdisensyoshadeslinggo-linggobiyernestuvofencingthemtooritwalsulinganturismonananalopagtiisanikinasasabikmasasabibutikijejusalatre-reviewtshirtbenefitsbalatbagalphilosophicalmaisiphmmmmdoneadventmajorpagka-maktolstructuredurithreeayanevenupworksakristannakapagsabipaghaharutaninsektonghumiwalaytv-showsabundanteumakbaykutsilyosisipainganyanasthmatagalogmatulunginipinamilinapakominamasdankasalshopeegrinsamoveryjobsbungasumamareservessumugodchoicestarwithoutbeingsumalialaalaerapmaibapersonscoincidencetagumpayvarioussapatubodfridaymalapadnakikilalangpambahaypinapasayamahawaant-ibangnangapatdancommercialwakasporbulongbayangmasukolpulitikoayabesesdiseasespeeppagodingatanbusumuwimalimitbumugapedemonitorreadregularmentestylesilocosnagpalalimpagsasalitatungawlabing-siyamiyanibabawbulaklakvelfungerendepinalambotmanghuliproducts:gisingmust