Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Ano?! Ibig sabihin.. hinde ako nananaginip nun??

2. Saan nagtapos ng kolehiyo si Peter?

3. Sa pag-aaral, mas nagiging matiwasay ako kapag maayos ang aking mga talaarawan.

4. Nag-aabang ang mga kabataan sa kalsada habang nagiigib ng balde-balde ng tubig para sa kanilang water balloon fight.

5. Yeah. masayang sabi ni Chad with matching thumbs up.

6. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

7. Nationalism has been used to justify imperialism and expansionism.

8. Malaki at mabilis ang eroplano.

9. Instagram has become a platform for influencers and content creators to share their work and build a following.

10. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

11. Unti-unting lumapad yung ngiti niya.

12. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

13. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

14. Gutom ako kasi hindi ako kumain kanina.

15. Tumitigil lamang ito sa gabi upang makapagpahinga ang mga hayop upang sa susunod na araw ang may lakas sila upang ipatuloy ang pakikipaglaban.

16. Sa muling pagtataas ng tungkod ng matanda, lalong dumagundong ang mga kulog at tumalim ang mga kidlat.

17. Sa tuwing pinagmamalupitan ako, lumalalim ang poot at humahantong sa galit.

18. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

19. Emphasis can be used to create a sense of drama or suspense.

20. Sandali na lang.

21. Hindi pa rin siya umaalis sa kinauupuang balde.

22. Emphasis is an important tool in public speaking and effective communication.

23. Nationalism has played a significant role in many historical events, including the two World Wars.

24. En el siglo XVII, el Barroco español produjo figuras importantes como Francisco Guerrero y Tomás Luis de Victoria

25. Maliit lang ang kusina ni Lola Oliva.

26. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

27. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

28. Les personnes âgées peuvent avoir des problèmes de sommeil en raison de la douleur et de l'inconfort.

29. The wedding rehearsal is a practice run for the wedding ceremony and reception.

30. At malaman ng maaga ang wasto sa kamalian.

31. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

32. Isang magdadapit-hapon, habang nagpapasasa si Kablan sa marangyang hapunan, isang uugud-ugod na matanda ang kumatok sa kanyang bahay.

33. Salatin mo ang kahon kung may natira pang laman.

34. Tinuro nya yung box ng happy meal.

35. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

36. Hindi pa rin siya lumilingon.

37. Hindi umimik si Lory sa mga tanong ni Chad.

38. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

39. The United States is the world's largest economy and a global economic superpower.

40. "Dogs never lie about love."

41. Oo malungkot din ako. Mamimiss kita.

42. May nakita ka bang maganda? O kabigha bighani?

43. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

44. Despite his success, Presley's personal life was plagued by controversy

45. Minsan, inaasikaso ko ang mga bagay-bagay ng aking nililigawan upang maramdaman niya ang aking pag-aalaga sa kanya.

46. They offer rewards and cashback programs for using their credit card.

47. Gawa sa faux fur ang coat na ito.

48. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

49. Maari bang pagbigyan.

50. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

Similar Words

following,

Recent Searches

followingnegro-slavesnaiilangkapangyarihanfiamasayabecamebalahiboveryselebrasyonbusogparolkastilangnaisbihasataksimatitigasmadungisbarongmahahanaymalapitansumisilipshowupuannauntogmarkedpamilihang-bayanbighaninangsinaliksikbumuhoslagnattonightpaboritongnag-aagawannagmamaktolmagisipdaanartssumugodnegativenagbagomagpuntasakristannagwikangpanunuksoreservestahimiknapansinihahatidnagre-reviewincrediblebroadcastingtiketseparationwriteproperlyasimbaitmagbabalapublishedmgaparasementobesidesliveyayaboracaymungkahitalemakabilihayaananibersaryoswimminguulitinmoneygaanorodonakalayuanbumotobayanbakitrelokantofreedomsginagawatelebisyonkahaponpingganlikodlayuninmakebabasapagkatinit4thfreemisaatacompositorespwedengmapadalidenneelectronicpagkaraababesourcenanghihinamadpopcornisipconsiderkulangautomationformsmagbibigaystyrermanakbointramurosumulanmaongtapusinpagdiriwangpagkalungkotnakapagproposesasabihinamerikabibilipulitikokakaibaginawafrescoharmfulmusicalesallepalancatiyanmagkaibagobernadorgulangkumakantanakasahodbiologinobodyduwendegasolinanakaka-innagtitiisburmahumihingibumagsakpangkaraniwanghalu-halowerenaglakadacademymarchipinabaliksupilinperomagdamagsuzetteumaagospakilutogranadaaniyagappamasahedisyembrecynthiakagandanagawanakapilanglasanakamitlunesnanahimikagadagapitodi-kawasacrecermangingibigusuariopinakidalainihandapaulit-ulitusedbroadcastsfuetakespupuntahatingsolarownisusuotendnapasukonagtutulakmakagawamakarating