Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

2. Gumanda ka lalo sa kulay ng suot mo.

3. Inumin mo ang gamot nang minsan isang araw.

4. Mayroong hinahabol na magnanakaw sa kalsada na inaabangan ng mga pulis.

5. Nung nagplay na, una kong nakita yung sarili ko. Natutulog.

6. La realidad es que a veces no podemos controlar lo que sucede.

7. Panahon ng pananakop ng mga Kastila

8. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

9. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

10. Sabi mo eh! Sige balik na ako dun.

11. Natakot ang pusa sa tunog ng paputok kaya't kumaripas ito papasok sa bahay.

12. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

13. Buwan ngayon ng pag-aani kaya si Mang Pedro at ang iba pang mga kalakihan ay nagtungo sa bukod para anihin ang mga pananim nila.

14. Sa likod ng mga tala, kahit sulyap lang, Darna

15. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

16. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

17. Sa di-kawasa ay dumating ang malungkot na sandali.

18. Kaano-ano mo si Juan Dela Cruz?

19. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

20. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

21. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

22. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

23. Ang Linggo ng Pagkabuhay ay pagdiriwang.

24. Oh sige na nga sabi mo eh. hehe.

25. Nasi uduk adalah nasi yang dimasak dengan santan dan rempah-rempah, biasa disajikan dengan ayam goreng.

26. The bank approved my credit application for a car loan.

27. Hello love birds! bati ko sa kanila nang makalapit ako.

28. I like how the website has a blog section where users can read about various topics.

29. You need to pull yourself together and face the reality of the situation.

30. Nagtatanim ako ng mga bulaklak sa mga paso upang magkaroon ng mga colorful na dekorasyon sa loob ng bahay.

31. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

32. The number you have dialled is either unattended or...

33. Ano-ano ang mga nagbanggaan?

34. Ano ang pinapanood mo sa telebisyon?

35. Sa panahon ngayon, napakahalaga ng mga taong bukas palad dahil sila ang nagbibigay ng pag-asa sa mga taong nangangailangan.

36. Malakas ang hangin kung may bagyo.

37. Sampai jumpa nanti. - See you later.

38. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

39. Si Lolo Pedro ay pinagpalaluan ng kanyang mga apo dahil sa kanyang mga kwento at payo.

40. She writes stories in her notebook.

41. Magsisine kami sa makalawa ng hapon.

42. Mahirap malaman kung ano ang nasa isip ng isang taong mailap.

43. Dyan ka lang ha! Wag kang lalapit sakin!

44. This can be a good way to grow your wealth over time, but it also carries risk

45. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

46. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

47. Umokay ang result ng pagsusulit ni Jayson matapos itong magsunog ng kilay.

48. Ang mailap na pangarap ay kailangan paglaanan ng pagsisikap upang magkatotoo.

49. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

50. Mauupo na lamang siya sa kanyang balde.

Similar Words

following,

Recent Searches

followingfollowing,magkikitapresidentialbooksocietyunitednakakaalamworldyou,commercialdrayberproductsmaiingaynakikini-kinitamagtatanimplantasculturaskarwahengrestauranttaxifilmscultivolot,medicaldownvideos,mamamanhikanhabitpilipinokuyapresidentchristmassuccesspresssongsvarietybabygovernmentincomecommunicateenergyaanhinshoppingsisentahealthkinagalitancommissionnaiwangeducativasmorningtinigilanloveduwendepacienciainternacionaltsongnararamdamanhoyrestawranpalagiblusamagbungayoueuropebokgameshanphonemarketplacesdealleaderscanadakabundukanhotelcountriesipinambilidogspatakbongpresleyadvertisingkamakailanmoneypapelkuneavailablespareteamprocesshigpitanvictoriadiretsahangheartbutmusiciansnapalitangmabigyanumiwaslifevideoafternoonelectionsejecutanusednakalilipashayaanhousegrahamcultivatedhealthierjeepneycover,televisiontenpagkokakbayanipinaulananpamumunobasapinapakaintag-arawmasarapmoviepahiramnalugmokmeaninggenenanalomedya-agwamaalwangdaangafterpagpapasanpapaanotraditionalageskayabanganmakapangyarihangreachjobumiinomofrecennagwalistransportationmagka-babyrimastinioeyedioxidepatientlumingontiyanpinasalamatanmateryalesroommarahascarenapatakboupodeathnalalabikalakiservicestinaposahasboypuntahanrenacentistaroleginacapitalsaritacombatirlas,kamandagtelephoneinilistaanteskabinataankakuwentuhanpuladelvideosbateryatheystaylittlebagentertainmentjudicialwerenanigasabangsamantalangbossinterestssellingconstitutionpaligidjenalate