Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Gusto kong mamasyal sa Manila zoo.

2. Ang pelikula ay ukol kay Jose rizal na lumaban para sa kanyang bayan.

3. Børn bør have adgang til uddannelse og sundhedsydelser uanset deres baggrund eller socioøkonomiske status.

4. Ang mga palaisipan ay maaaring nagbibigay ng mga oportunidad para sa paglutas ng mga problema at pagtugon sa mga hamon sa buhay.

5. Dedicated teachers inspire and empower their students to reach their full potential.

6. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

7. Gaano ka kadalas kumain ng baboy?

8. Les employeurs peuvent utiliser des méthodes de travail flexibles pour aider les travailleurs à équilibrer leur vie professionnelle et personnelle.

9. Human trafficking is a grave crime that needs immediate action worldwide.

10. She is not drawing a picture at this moment.

11. This has led to increased trade and commerce, as well as greater mobility for individuals

12. He was already feeling sad, and then his pet passed away. That really added insult to injury.

13. Sa sobrang pagpapatubo sa perang ipinauutang, galit na galit ang mga mangingisdang hindi makapalag sa kaswapangan ng kanilang kababayan.

14. Dahil sa alam nito na magaling siya sa kanyang kakayanang paghahabi hinamon nito ang sino man na magkipagtagisan sa kanya.

15. There are a lot of books on the shelf that I want to read.

16. Saan siya nagtapos ng kolehiyo?

17. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

18. La tos puede ser un síntoma de COVID-19.

19. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

20. Ang pag-asa ay nagbibigay ng positibong pagtingin sa buhay at mga pangyayari kahit na may mga suliranin at pagsubok na kinakaharap.

21. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

22. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

23. Bakit di mo 'to sinabi sa akin?

24. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

25. Ang mga pabango sa tindahan ay nag-aalok ng iba't ibang mga amoy, mula sa mabango hanggang sa matapang.

26. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

27. The airport was busy, and therefore we had to arrive early to catch our flight.

28. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

29. Siya ay madalas mag tampo.

30. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

31. Ang pagpapahalaga sa ating kalikasan ay mahalaga para sa kinabukasan ng susunod na henerasyon, samakatuwid.

32. Users can follow other accounts to see their tweets in their timeline.

33. Football is played with two teams of 11 players each, including one goalkeeper.

34. Hindi ako sang-ayon sa pagtrato ng ibang mga tao sa kanilang mga kapwa.

35. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman.

36. A couple of goals scored by the team secured their victory.

37. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

38. Elektronik kan være en kilde til underholdning og sjov.

39. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

40. Maaf, saya terlambat. - Sorry, I'm late.

41. El graffiti en la pared está llamando la atención de la policía.

42. Ang mga dentista ay maaaring mag-rekomenda ng mga produkto na dapat gamitin upang mapanatili ang malusog na ngipin.

43. Have you studied for the exam?

44. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

45. El arte puede ser utilizado para transmitir emociones y mensajes.

46. Sa muling pagtuturo ng relihiyon, natutunan ng mga bata ang konsepto ng purgatoryo.

47. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

48. Padabog akong umupo habang dumadating na yung order nya.

49. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

50. Después de hacer la compra en el supermercado, fui a casa.

Similar Words

following,

Recent Searches

followinghumihingiawitanmaskinerikatlongmagalitmangingisdangpasahedireksyonmakalingpakilagayurimaaksidentelugawnilayuansikatpayongbayaninghinampasagilaallebopolsnuevostaksipauwistocksnenaginawahundredkamustatsuperseryosongiyakestilosforstådesarrollarhagdanhikingpinalayasmalimitbinilhanexhaustedbestkumukulokinantaiskedyulvetoedsakingdomhumblemaaaripalangmalakiumayoseducativaslegislationkabosestaingadietwarisolarfionatinioitinagoreachpulubiresortsamfundcomposteladalawumingitduonresignationtonightcarepiecesfuelfiainiwansaidmakalaglag-pantygasolinamahahaliklanamakukulaymahahabangbinuksanchavitpshsumusunoniliniszoomvampiresmasdanbusyangbriefbobodisyempremasklegendsespadainalokellaipinabalikmatabaexperthomeworksumakit10thsusunduinperangpasyamemorialnagkasakitagekasinggandaplayslibrelastinglockdowngrabeilanmakilingaddressidea:finishedbalitatermryanscalecertainyeahbatasequeuniquestophellopagkaraarieganalalamanhayaangkaano-anobinibilimakidalorodonafreedomsbehalfgatolmapagkatiwalaanminahanpopulationkalupivirksomheder,nagkakatipun-tiponrolledhidingunfortunatelymagsasalitahulumananalomakabawipinagalitannagpapakainpaglulutonasisiyahannagpalalimnabiglaambisyosanggovernmentmagbantaymahinogubodkinalalagyanmateryalesnapatulalaisinakripisyoincluirganitofulfillingtamisnagbasabodaikinabubuhaygayundinginugunitanakapagngangalitgeologi,nanghihinamadbiocombustiblesofficeconvertidasabenewowbumababapocababaeanimotomarshowsulam