Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Ang labi niya ay isang dipang kapal.

2. Yehey! si Mica sabay higa sa tabi ko.

3. Nagsmile siya sa akin, Bilib ka na ba sa akin?

4. We have finished our shopping.

5. Ang maalikabok at baku-bakong lansangan ng Nueva Ecija ay kanyang dinaanan.

6. Isang matandang lalaki naman ang tumikim sa bunga.

7. In 1977, at the age of 42, Presley died of a heart attack

8. All these years, I have been learning and growing as a person.

9. Mahusay gumawa ng bahay ang kanyang tatay.

10. Las escuelas también pueden ser religiosas o seculares.

11. Ang laki ng gagamba.

12. Mahirap maging may agam-agam sa buhay dahil ito ay maaaring magdulot ng pagkabalisa.

13. Gigising ako mamayang tanghali.

14. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

15. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

16. Starting a business during an economic downturn is often seen as risky.

17. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

18. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

19. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

20. Ha? Ano yung last na sinabi mo? May binulong ka eh.

21. Pakibigyan mo ng tip ang waiter.

22. Ayaw ng kaibigan ko ang mainit na panahon.

23. May maruming kotse si Lolo Ben.

24. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

25. Magkita na lang tayo sa library.

26. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

27. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

28. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

29. Kapag sumabog ang mga salot ng droga, hindi lamang ang tao ang nasasaktan, pati na rin ang buong pamilya.

30. Mahal ko iyong dinggin.

31. Sa gabi ng handaan ay ipinatawag ng Ada ang lahat ng hayop at halaman.

32. He bought a series of books by his favorite author, eagerly reading each one.

33. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

34. However, there are also concerns about the impact of the telephone on society

35. Mayroon nang natanggap na impormasyon ang pulisya tungkol sa pagkakakilanlan ng salarin.

36. Hindi ko gusto ang taong nagpaplastikan dahil wala naman itong kabuluhan.

37. He used his credit to buy a new car but now struggles to make the monthly payments.

38. Sa kalagitnaan ng pagbabasa, nagitla ako nang biglang mag-flash ang ilaw sa kuwarto.

39. Sometimes all it takes is a smile or a friendly greeting to break the ice with someone.

40. Mahusay maglaro ng chess si Wesley.

41. Les impôts sont une source importante de revenus pour l'État.

42. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

43. Hindi ko kinuha ang inyong pitaka.

44. Ang presidente ng Pilipinas ay nagpabot na ng ayuda sa mga mahihirap.

45. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

46. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

47. El nuevo libro de la autora está llamando la atención de los lectores.

48. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

49. Lumapit ang mga tao kay Ana at humingi ng tawad sa kaniya sa pagiging marahas ng mga ito.

50. "Dogs come into our lives to teach us about love and loyalty."

Similar Words

following,

Recent Searches

kaloobangfollowingoktubrelikodnamataywidelyilagaysumasakaymamihawlanahigabarcelonabutchpasyentekadalasofferkantosumusulatmesanghimayinlinggongsnadennetravelernakatitigmagbibiyaheeskwelahankonsultasyonlimitedisinuotmariegreensinasakyansiksikankalupimatabangresearch,galitpisngisorrynakatunghaybutterflybundokbibilitinapaynanaloluluwasmakapangyarihaninaabutantraditionalsisidlanmatalinosilavetonamumutlanasasabihansumakitkidkirankasoymurangnag-iyakanhistoriacitizensnatanongseriousmayamangkunearbularyomayakapvedrelievednapadaanluneskalaronapakanakakapamasyalpataykasopingganpumitasmahahanaynanunuriunahinnamatatawagnangingilidangkopmahabangnapawikinamumuhiantiniklingataquespootnyekumaencoatmedikaliniintaynalalabingnahulinagtawanandoktornapakabilispagsagotmakapalmesteuphoricsabihingmahinogalmacenarexhaustedculprituniquesumagotmakukulayinternabastarawtsonggostyrerfrescoumilingprimerschedulenagdalatungkodasignaturacallrestawanmakahiramdoingpinaladsurroundingsboxstopunattendedkabuhayannaghuhumindigtaposinfinitynagtungohmmmmdrewcigarettesiniyasatgagnanlilisikspentnitongsumalaherramientatinitindanagmungkahinapapasayaincluirunti-untitravelstaplepagsayadsoundnapadpadnahantadgraduallypunong-punokwebapunongopoanaklungsodpinaliguanpaskongvirksomheder,sinasadyaapatnapudollytagalogpiratabintanasalamatstartbanlagisinamacountrysafeganidtwitchfonostoothbrushbuung-buoconventionaliniirognagrereklamopaulajanpakainhalosbabaesumamafeedback,lunas