Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Itinaas niya ang tirante ng kamiseta.

2. Andyan kana naman.

3. Hindi niya inaasahan ang biglaang promotion na ibinigay sa kanya ng kanyang boss.

4. Ang matandang babae ay pinagpalaluan ng buong barangay dahil sa kanyang karunungan at malasakit.

5. Jacky! Pare! nakangiti niyang sabi habang papalapit kami.

6. Isulat mo ang pangalan mo sa papel.

7. Dahil sa tagumpay ni Hidilyn Diaz, mas maraming Pilipino ang nagkaroon ng interes sa weightlifting.

8. Drømme kan være en kilde til trøst og håb i svære tider.

9. Las labradoras son una raza de perros muy populares en todo el mundo.

10. Ang kaniyang pamilya ay disente.

11. Women have often been the primary caregivers for children and elderly family members.

12. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

13. Ang taong lulong sa droga ay parang nasa bangin na patuloy na bumababa hanggang sa wala na siyang mahawakan.

14. Nagmamadali na ako ngunit dumaan pa sa gasolinahan ang driver ng dyip.

15. They clean the house on weekends.

16. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

17. It's time to pull yourself together and start taking responsibility for your actions.

18. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

19. Nagising na si Angelica matapos syang operahan sa loob ng limang oras.

20. Ofte bliver helte hyldet efter deres død.

21. The bird sings a beautiful melody.

22. Nang malapit nang magdilim, kumaripas na ang mga magsasaka pauwi sa kanilang tahanan.

23. They are cleaning their house.

24. No dejes para mañana lo que puedas hacer hoy.

25. Eine hohe Inflation kann zu einem Anstieg der Zinsen führen, um den Anstieg der Preise auszugleichen.

26. Walang anuman saad ng mayor.

27. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

28. I can tell you're beating around the bush because you're not looking me in the eye.

29. In the land of Narnia, four siblings named Peter, Susan, Edmund, and Lucy discover a magical wardrobe.

30. Hiramin ko ang iyong bike para sumali sa cycling event sa Sabado.

31. Eine klare Gewissensentscheidung kann uns helfen, Verantwortung für unsere Handlungen zu übernehmen.

32. Hindi ko matitiis ang mga taong maarte sa mga pagkain na hindi naman talaga kailangan.

33. Kasingtigas ng loob ni Sultan Barabas.

34. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

35. I used my credit card to purchase the new laptop.

36. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

37. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

38. Nang malaman ko ang kasinungalingan ng aking kaibigan, nagpalabas ako ng malalim na himutok sa aking sarili.

39. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

40. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

41. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

42. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

43. Kailangan nating magbasa araw-araw.

44. Tantanan mo ako sa legend legend na yan! hahaha!

45. Nasa gitna ng kanyang pagsasalita, napadungaw siya sa kanan at nakita ang isang bata na tumatawa.

46. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

47. Nakikisalo siya sa pamilya at totoong nasisiyahan siya.

48. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

49. Tengo tos seca. (I have a dry cough.)

50. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

Similar Words

following,

Recent Searches

followingmaingatkapagnandoonabotnegosyanteniyoconnectnag-uumigtingkontinentengpag-indakmagsuotkayanaglabalaloinakalai-markpasensiyavegasmensrosasnakakalasingsumamadiligingalitandaminggigisingturocomputerbagpangilaayusinjuanitomabiroisinuotsaan-saantinatanongiginawadmasarapnauwinagsisigawsagutinenhedermapagbigaymalihumahagoksilasimuleringerrecibirpunung-punoincreaseiatfbroughtmemodoonnagdaramdammanggapasokexitmancubicleninaclubmatangisinarasapagkatofrecennanggigimalmalleytenagsalitapaladiscipliner,pinagbubuksankinakailangananitcementnamantongresultkumaripasautomationdiamondproducireroplanosuotmatapangpaskongunitreturnedbutterflybulaklakkawayannasahodgusting-gustoblusapitoinvestbulalasinaasahangtermtandatingnannauliniganreferskumainkapwalawapintodirectabangkangmillionshadlangnagsabayparagraphsnagsisihankabuhayanmananagotseparationdedication,enfermedadessalapilitiguhittirantekamisetanapaluhasabihinnooddagatgoalmagtigildoble-karakangkongmagworkpulismakausapshockniyonkinaiinisansubalitpag-aaralgulatewansamakatuwidsaanpaanansangkalanmasungitmarahaspagdaminatinbaguiopagkainlangyakaibiganpetyatakasikagalakanitoabanganboracaykayang-kayangusingmagitingwarithanksgivingpanibagongsapatoskainankatutubobayanlumipadnagpapakinisklasruminsektobukaambisyosangcommerceakmabasahinpicturedulonag-umpisabrucetowardsnag-asarannanlalambotartistayayakaarawanpilipinodoktortabihansadyangsyapagkalitominu-minutomahiyalumaban