Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Kings may wield absolute or constitutional power depending on their country's system of government.

2. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

3. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

4. Napakabilis ng wifi sa kanilang bahay.

5. Nahawakan ko ang katawan ko, Umabot ba kami hanggang dun?

6. Alles hat ein Ende, nur die Wurst hat zwei.

7. They do not skip their breakfast.

8. Beaucoup de gens sont obsédés par l'argent.

9. Takot, nanginginig ang kanyang mga daliri.

10. Si Juan ay nadukot ang cellphone dahil sa isang magnanakaw sa kalsada.

11. ¿Dónde está el baño?

12. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

13. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

14. Dala ito marahil ng sumpa sa iyo ni Matesa.

15. Alam na niya ang mga iyon.

16. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

17. Iyong kulay itim na bag ang bag ko.

18. She admires the philanthropy work of the famous billionaire.

19. We sang "happy birthday" to my nephew over video chat.

20. Hindi dapat natin pigilan ang ating mga pangarap, kundi pagsikapan nating tuparin ang mga ito.

21. Have you eaten breakfast yet?

22. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

23. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

24. No hay palabras suficientes para agradecer tu amor y apoyo.

25. Ngunit kahit ganyan ang kinalalagyan.

26. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

27. Scissors should be kept sharp to ensure clean and precise cuts.

28. Ang daming palamuti ang nakalagay sa kanyang cake.

29. She has been working on her art project for weeks.

30. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

31. Ang aking kabiyak ay ang aking tahanan, kung saan ako nararamdamanang tunay na pagmamahal at suporta.

32. El orégano es una hierba típica de la cocina italiana, ideal para pizzas y pastas.

33. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

34. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

35. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

36. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

37. Wala siyang sapat na budget, samakatuwid, hindi niya mabibili ang gustong cellphone.

38. La ganadería y el cultivo de pastos van de la mano en muchas explotaciones agrícolas.

39. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

40. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

41.

42. La tormenta produjo daños significativos en la infraestructura de la ciudad.

43. Ang mommy ko ay masipag.

44. Kailangan mong malaman kung sino ang mga taong bukas palad sa iyo upang hindi ka masaktan.

45. They admire the way their boss manages the company with fairness and efficiency.

46. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

47. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

48. Selamat jalan! - Have a safe trip!

49. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

50. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

Similar Words

following,

Recent Searches

followingdogsipinambilinakikilalangenergy-coalerhvervslivetmateryalesnagtrabahogataspuntahaninasikasopatienceitinatapatinteriorbinitiwanestablishgalaankunekuligligcitizenspioneersaidnyaperfecttodayartistsnapasigawagilapopulationbumabanyeplayedbatoktulalanabigayiniangatcolourbetweenibilipasigawpagbabayadpagpasokdaddynakisakaymahabolfrogkapeteryaatensyonpopcornnakabiladmasdanstudentscornertungopagsayadbinge-watchingnaglakadrememberednoodumaramiclockdiyositinalioperatemininimizetargetsetsdisappointpandidirinotebooksourceikinalulungkotpa-dayagonalregularmenteflashgabriellumusobnapapalibutankinatatalungkuanglubossearchproyektomatahabaaggressionnagpupuntakainislabing-siyammagpaniwalailangearutaknakapasaumanoipagmalaakimatakawpinag-usapanmagpakasalgreatbasurabatang-bataglobalprosperkawili-wilinakauslingtinutoppagtatakaniyakappuedestemperaturaumabognagsasanggangniyogsanasamfundtransportmidlerpakiramdamkombinationhmmmi-rechargemagpa-picturephysicalsentencekataganangpangambakaurinegosyokundimanginagawalcdwritesagaplabahinpagkalungkotinsektongamparoopgaver,kamakailanshoppingkawalanindividualpinakamatabangmangkukulamteknologipinapasayapaligsahanbagkus,nakahaintaga-ochandodurantekabutihantinataluntonhumabolpracticeskaibiganabanganmalawakmaanghangeyeinspirasyonalikabukinmagpasalamatmatalinonareklamoninongbayangnasisiyahanimportantesmaipagmamalakingflamenconakakagalingbinatangpalitanmumuntinglamanseryosongangalmakasilongmangungudngodmagtakaimbesnakapuntatumatanglawbiliendingmamataansarilinowclearetolightswaaaloriferrersyapagtatanimcoughingomglagi