Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. They play video games on weekends.

2. I sent my friend a bouquet of flowers and a card that said "happy birthday."

3. Limitations can be challenging, but they can also inspire creativity and innovation.

4. They are not running a marathon this month.

5. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

6. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

7. Some limitations can be temporary, while others may be permanent.

8. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

9. Limitations can be a result of fear or lack of confidence.

10. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

11. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

12. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

13.

14. My daughter made me a homemade card that said "happy birthday, Mom!"

15. Naiinggit ako sa ibang hayop at halaman na tuwang-tuwa kapag may handaan sa kagubatan.

16. She wakes up early every morning to exercise because she believes the early bird gets the worm.

17. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

18. We sang "happy birthday" to my grandma and helped her blow out the candles.

19. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

20. There were a lot of people at the concert last night.

21. Bunso si Bereti at paborito ng ama.

22. Hindi maiiwasang magkaroon ng mga biktima sa digmaan, kasama na ang mga sibilyan.

23. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

24. Ipinagmamalaki ko ang pagiging Pinoy dahil sa mayamang kasaysayan ng ating bansa.

25. To break the ice at a party, I like to start a game or activity that everyone can participate in.

26. Kumain na tayo ng tanghalian.

27. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

28. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

29. Eine Inflation kann auch die Investitionen in Forschung und Entwicklung beeinflussen.

30. La paciencia es una virtud.

31. Nagtapos siya ng kolehiyo noong 1982.

32. Inialay ni Hidilyn Diaz ang kanyang tagumpay sa Diyos at sa kanyang pamilya.

33. Pupunta si Mario sa tabing-dagat sa hapon.

34. Il faut que j'aille faire des courses ce soir.

35. Has she met the new manager?

36. I forgot your birthday, but here's a card anyway. Better late than never, right?

37. Makikita mo, maganda talaga ang lugar.

38. Maraming taong sumasakay ng bus.

39. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

40. Mahalaga ang pagtitiyaga sa bawat bagay na ating ginagawa, datapapwat ay may mga pagkakataon na hindi natin nakukuha ang inaasahan nating resulta.

41. Nangangako akong pakakasalan kita.

42. Siya ay maramot sa pagbibigay ng tulong kahit marami siyang pera.

43. Mahilig maglaro ng video games si Marvin.

44. Maaaring magbago ang ekonomiya ng isang bansa dahil sa digmaan.

45. However, there are also concerns about the impact of technology on society

46. Ang kanyang malalim na pangarap ay animo'y imposibleng maabot ngunit patuloy pa rin siyang nagsusumikap.

47. El internet ha hecho posible el trabajo remoto y la educación a distancia.

48. Pinadala na nya ang kanyang resignation letter sa pamamagitan ng email.

49. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

50. Mahalaga ang maagap na pagtugon sa pangamba upang maiwasan ang mas malaking panganib.

Similar Words

following,

Recent Searches

followingskillspabilihirammaynilanaghubadininompahabolbinitiwanmagpakaramimaestraninyongtusongkanayangnagpasanestadosmaghapongbanalmaluwaggawingunangmulsenateanungpinoyhuertoninamatulunginbantulotrenaiakataganglilikovegassongsinihandasarabangkomalikotsundaenasanherramientamagbigayaninalagaanheartbreaktokyokumampiiwasantatayohigh-definitionsigurobinibilangikawnegosyoninyothroatlaruanpinagkasamamataaselenamatipunoganitogrammarreachbingoinulitseniorpriestbasahinpasigawsonidomalayangbumabagfuesnobritoreboundcenteriguhitkadaratingmassesnagbasamaariredigeringjackyalamadverselydemocraticwidereducedtontryghedcommunityknownmesangscaledayyoungmabutingharimillionslaylayteachuriideyasamuumiinitputingbituinefficientpublishedleadtopichigheststructureipinalutomitigategapayanspendingpagsubokawaresteerslaveimpacteddinalaimprovestylesstudentsadditionallysumapitthereforechambersnagpuntaextrabardisensyomarahaspinagmamalakijuegosdesisyonanrangepdadawmultogabinghawaiinilaosasiatickunwareportbabamagulayawinabutangotnagkabunganakauslinginiibigibiglimitisasabadipinatawagtinutopmanilbihankontrakutsaritangkaybilisteacherbultu-bultongcigarettesinalokprosperannaallkadalasjagiyamapuputipapagalitanpagpapasannagsisigawnakakasamamag-plantpagkakalutosalu-salonakagalawkasaganaanjocelynsoundrenatofulfillingtuvolimitednataposkatagalanandresbalatnanghihinamadkakuwentuhanmagkahawakmaipantawid-gutom