Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

2. Babasahin ko? medyo naiilang kong sabi.

3. Ang pogi ng BF mo Maria, sana-all!

4. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

5. Hindi ako sang-ayon sa mga pangyayari sa paligid natin ngayon.

6. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

7. La paciencia es una virtud que nos ayuda a ser mejores personas.

8. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

9.

10. Gutom ka? kinagat ko ang labi ko at tumango sa tanong nya.

11. Ayaw ko ng masyadong maanghang/matamis.

12. Batman, a skilled detective and martial artist, fights crime in Gotham City.

13. Catch some z's

14. Naging kasangkapan ng mga Espanyol ang Katolisismo upang lalong mapadali nila ang pamamalakad dito.

15. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

16. Les personnes âgées peuvent avoir des relations affectives et intimes avec leur partenaire.

17. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

18. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

19. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

20.

21. Coffee is a popular beverage consumed by millions of people worldwide.

22. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

23. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

24. She started a TikTok account to showcase her art and gain more exposure.

25. Lumipat si Carlos Yulo sa Japan upang mas mapalakas ang kanyang training sa gymnastics.

26. Ang aming pagsasama bilang magkabilang kabiyak ay puno ng pagpapahalaga at respeto sa isa't isa.

27. Nasi uduk adalah nasi yang dimasak dengan santan dan rempah-rempah, biasa disajikan dengan ayam goreng.

28. Ang malawak na mga taniman ng mga prutas at gulay ay nagpapakita ng isang industriya na mayabong at umuunlad.

29. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

30. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

31. Sino ang mga pumunta sa party mo?

32. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

33. I am absolutely thrilled about my upcoming vacation.

34. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

35. Los héroes son personas valientes y audaces que se destacan por su coraje y determinación.

36. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

37. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

38. Napangiti ang babae at umiling ito.

39. Ipinagbibili ko na ang aking bahay.

40. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

41. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman.

42. Ang albularyo ang tumulong sa pamilya para maalis ang sumpa sa kanilang lupa.

43. Le jeu est une forme de divertissement dans laquelle on mise de l'argent sur un événement aléatoire.

44. Kapag aking sabihing minamahal kita.

45. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

46. Sino ang maghahatid sa akin sa pier?

47. "Ang hindi magmahal sa sariling wika, daig pa ang malansang isda" ay isang bukambibig na nagpapahayag ng pagpapahalaga sa ating sariling wika at kultura.

48. Guten Abend! - Good evening!

49. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

50. Magsabi ka ng totoo, kung di ay dadalhin kita.

Similar Words

following,

Recent Searches

followingikatlonglaamanglabahinpampagandakataganghinampasipinangangakbihasapauwimaranasanmagbubukidbilanggojennyinintaygabiipagmalaakinamankakayanangkaybilisnanoodnaligawalasbagkusganidbestidamatitigassellinganghelmonumentoaaisshlumulusobpogifilmsnagpuntayaribateryalipadsitawsinemaluwangtonightproductionheheumaliskayaorderinmerryamonakatingingindustrypusongspeecheskatabingterminoshowsaywangisingpropensofiawordtransparentlackheyperangreservednathansorrydedication,datimuchasipinakoeyepartnersumapitwalletcommunicationsbilerfriesfansmakakataloprogramamakeulingsumusunodbinilingroughcablelibagmalakingmulighedmaramotmakikinignagsilabasanbumababapagkamanghasamfundslavetumakbounconventionalnagsamamalayangmanghikayatmaskarasiguradoentrancepaketecuentannag-oorasyonsang-ayonsilaparolpupuntahanpaliparinmabangowaybukodnatanggaphumahagokpakialamseryosongiyotheirsagotricaworkmabigyanfotosnaglalatangpatongtwitchkulisappumasokpatungotumawagnamakalakicashganitopasinghallalargatinatawagpinagpatuloyrevolucionadokawili-wilimakakakainluluwasmagbabagsikpagpapautangpaghalakhakobserverernakapagproposepinagalitanpambatangsinasabitiktok,kahariannagpakunotmasayahinmaliksiwatawatpapalapitnakarinigspillnagtaposbinge-watchingtinuturokangitantilgangperpektingdiinmaabutancorporationkulunganabundantemalulungkotexigentetalinobarrerastuklastindahantanghalidurantetumindigtataasnagbentalilikohinanaplilipadlumbaygawanatuyopopulararalsumasaliwinnovationkumapitcompletamenteturonhumabol