Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Tengo dolor de garganta. (I have a sore throat.)

2. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

3. He has written a novel.

4. Sa hirap ng sitwasyon, nangahas siyang humingi ng tulong mula sa mga estranghero.

5. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

6. Te agradezco por estar siempre ahí para mí.

7. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

8. Road construction caused a major traffic jam near the main square.

9. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

10. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

11. Les enseignants doivent évaluer les performances des élèves et leur donner des feedbacks constructifs.

12. The library has a variety of books to choose from, ranging from classics to modern literature.

13. They clean the house on weekends.

14. Gusto kong sumama sa nanay ko sa tindahan.

15. Nagpaluto ang nanay ko ng adobo sa akin.

16. He used his credit to buy a new car but now struggles to make the monthly payments.

17. Ang COVID-19 ay laganap sa buong mundo.

18. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

19. Ang kagutuman ay laganap sa mga lugar na may kalamidad.

20. Los héroes pueden ser tanto figuras históricas como personas comunes que realizan actos heroicos en su vida cotidiana.

21. Selamat pagi, bagaimana kabar Anda? - Good morning, how are you?

22. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

23. A lot of people volunteer their time and resources to help those in need.

24. Halos lahat ng mga misa sa aming parokya ay may awiting Bukas Palad.

25. Los bebés pueden necesitar cuidados especiales después del nacimiento, como atención médica intensiva o apoyo para mantener la temperatura corporal.

26. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

27. Supreme Court, is responsible for interpreting laws

28. Saan naman? nagtatakang tanong ko.

29. Kahit ubuhin sila sa nakasusulasok na mga basura, araw at gabing nagbantay ang mga taong bayan at mga kawal.

30. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

31. Sa pagkakaroon ng kalamidad, ang mga biktima ay nag-aapuhap ng emergency relief mula sa mga rescue teams.

32. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

33. "Tuloy po kayo," ani ng matanda sa bisita niyang dumating.

34. Nag-aaral siya sa library gabi-gabi.

35. Nasa labas ka ba? Teka puntahan kita dyan.

36. Nagkakaisa ang aming angkan sa pagpapahalaga sa edukasyon.

37. My sister gave me a thoughtful birthday card.

38. Binentahan ni Mang Jose ng karne si Katie.

39. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

40. Papunta siya sa Davao bukas ng tanghali.

41. Para sa kaibigan niyang si Angela

42. Einstein was married twice and had three children.

43. Dapat magkaroon ng patas na pagtrato sa lahat ng sektor ng lipunan, kabilang ang anak-pawis.

44. Walang password ang wifi ng kapit-bahay.

45. Better safe than sorry.

46. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

47. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

48. Walaupun Indonesia menghadapi tantangan dalam hal konflik keagamaan, mayoritas penduduk berusaha memelihara keharmonisan dan menghormati perbedaan agama.

49. Sa pag-aalala pala sa kapatid ay sumunod si Perla at kitang-kita niya nang mahulog siya sa ilog.

50. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

Similar Words

following,

Recent Searches

followingbahagyangairplanesbooksdiaperbuhokestiloskamotecalidadgjortkambingkendialagatipreguleringgraphicbigongvetoskyldeshmmmtagalogmayamangtinitindaplagasanifestivalnagbungaclientspeeppshcivilizationdinalawcontestlimosshopeeremainpinatidcornersstevemalimityoungmapakalistorenucleariosfacebookjerryirograwipihitenvironmenthapdiexpectationsstudiedgeneratebringinguminomboxbornspreadsettingtopicgitarabituinandroidkapilingbroadcastinguniquecompleteseparationpagdudugomalapalasyopinatayjoshtumatawadmagingsparksigurofuelporbanalunosnag-umpisaadditionallyworkingaralliboeconomykadalasmag-asawangagapandemyadeclarejerometelevisednapilitandulopintorememberedkumustamanggagalingisinulatpakanta-kantangeskwelahanpagpapasannagtutulakdapit-haponbuung-buonabalitaannagpapakainespecializadasnagmistulangnagpabotmagkaibangbefolkningen,kumidlatnagpuyosturismonakayukoopgaver,magbayadmakakibotemparaturakumakainkayabanganfestivalesmasaksihanmatagpuantinaylalakadgovernmentmumuntingcourtmaligayamagisipiniirognalangmanahimiknatanongtog,kastilangpropesoranumangmagsugalbyggetrektanggulomaya-mayamaluwagkumantabarcelonakamalianbinitiwannaantigkirbyhalinglingumupoalangantanghalirepublicansementokakayananexperience,probinsyaquarantineheartbeatbenefitsgumisingrequierennapakanagitladasalculpritjuanphilosophicalthroatnararapatantokahasmatikmanhastasellingkutodpasigawdalagangbililaronghundreddefinitivocharismaticltoproductskasakitnasannaglokokadaratingpanayvehiclessalarininaboracay