Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

2. Kailangan ng sapat na pagpaplano upang maipon ang sapat na pera upang mabayaran ang utang sa tamang panahon.

3. Pasensya naman, anak rubber shoes ako eh.

4. Walang bagay na di makita at agad tinatanong ang kanyang ina.

5. Dahil lumamang naman sa pagkakataong iyon ang mga mababangis na hayop, sa kanila lumapit si Paniki.

6. Nagtawanan kaming lahat sa hinirit ni Kenji.

7. Kailan ipinanganak si Ligaya?

8. Have you been to the new restaurant in town?

9. Ibinigay niya ang kanyang pag-ibig at suporta sa gitna ng mga pagsubok.

10. Magpapabakuna ako bukas.

11. Es importante trabajar juntos para abordar la pobreza y promover un mundo más justo y equitativo.

12. Les personnes motivées ont tendance à être plus productives et à atteindre leurs objectifs plus rapidement.

13. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

14. Si Marian ay isang sikat na artista sa Pilipinas.

15. Hun har en fortryllende udstråling. (She has an enchanting aura.)

16. Hinihiling ko lang sana na sa aking pagpanaw ay kunin mo ang aking puso, sunugin mo, at ilagay sa banga ang abo nito.

17. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

18. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

19. My boss accused me of cutting corners on the project to finish it faster.

20. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

21. She is playing with her pet dog.

22. Il est également important de fixer un budget et de limiter son risque pour éviter de perdre plus que ce que l'on peut se permettre.

23. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

24. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

25. Hindi ninyo madadala sa hukay ang yaman ninyo.

26.

27. Hindi ho, paungol niyang tugon.

28. Nagdiriwang sila ng araw ng kalayaan.

29. Naman! Alam niyo yung feeling na alam kong siya na talaga?

30. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

31. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

32. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

33. Kilala si Hidilyn Diaz sa kanyang malakas na paninindigan para sa mga kababaihan at atletang Pilipino.

34. Det er en stor milepæl at blive kvinde, og det kan fejres på mange forskellige måder.

35. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

36. The scientific community is working to develop sustainable energy sources to combat climate change.

37. Pinapakain ng pulotgata ang mga langgam sa aming bakuran.

38. The wedding photographer captures important moments and memories from the wedding day.

39. We have a lot of work to do before the deadline.

40. At naroon na naman marahil si Ogor.

41. Beast. sabi ko pagkalapit sa kanya.

42. They are not shopping at the mall right now.

43. Ano ang pangalan mo? ang tanong niya sa bata.

44. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

45. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

46. Masaya ako tuwing umuulan at kapiling ka.

47. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

48. Palayo na nang palayo ang tunog ng kampana habang umuusad ang gabi.

49. Kucing sering dijadikan sebagai hewan peliharaan karena dianggap dapat menghibur dan menemani pemiliknya.

50. The acquired assets included several patents and trademarks.

Similar Words

following,

Recent Searches

paliparinhistoriafollowingpagbabasehanagilacampaignsmaramotnababalotlumbaylilikotmicaniyomatangumpayphilosophicalhelpedtulangtiyantilatawanapilitangtsinelassalatinbritishtalentofrecennagisingmatitigasbuntissusimasarappalakastarmamuhayubod1929massessaladiagnosticbitiwantonightfar-reachingmahahabaprojectsbasahinkasingtigasnakatingingcasamapaibabawbumabagmalambingmalumbaymartesfreelancerusedburdenpanaysinapakspeechesmayosaidbusiness,inaasahanghonggulayewandetteayosumaapawinformationourlorenaoftenanaisinoutpostshowdeleimaginationmapaikotkumalathumingacleanflyhatingworkdaytelevisedeksamochandoipapainitimpitpowersbetweencertainiginitgitleftnutsnagbabagadalawamputheretag-arawspansnutrientsmanuelwhetherkasawiang-paladfurybagayplacepinatidpagkakatayopagbigyanpagbabayadpopularizenakikilalangitinaasmaglutohealthvehiclesteachsumuotrestawanmahihirapprogrammingnag-aagawanpinangalananoutlinesnapakatagalnahahalinhanmaninipismagasawangkaninumaninagymfuncionesenfermedades,nakuhabototssspaynaguguluhanglagilabinsiyamkagalakaninintayiniisipinatakegagawingabicrazyadverseadaptabilitynaka-smirkbumuhosattorneyexhaustionpacienciabotongmournednagpuntanovellesbahagyapulgadaestasyonmabaitpagputipaskongmalamangkusinerokasihayaeroplanes-alltechnologyknow-howmundoitakpartnalamanganangnotumiibigeithercrucialjunjunaraw-statenamumutlainaantaycolornakasandigenvironmenttv-showsitinatagnanoodyumabongmapamadulassorryadditionexpectationsinirapanregulering