Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Susunduin ako ng van ng 6:00am.

2. A bird in the hand is worth two in the bush

3. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

4. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

5. Ano ho ang gusto niyang orderin?

6. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

7. Nabagalan ako sa simula ng pelikula.

8. Sa sarili, nausal niyang sana'y huwag siya ang maging paksa ng paghaharutan at pagkakatuwaan ng mga agwador.

9. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

10. Salud por eso.

11. In conclusion, the telephone is one of the most important inventions in human history

12. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

13. Ilang beses ka nang sumakay ng eroplano?

14. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

15. Minsan kailangan din nating magmangiyak-ngiyak para maipakita natin ang totoong nararamdaman natin.

16. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

17. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

18. Aba! Bakit naman kita ililibre aber?!

19. Ang kumbento ang madalas tambayan ni Father at Sister.

20. Upang makita niya ang babaing gaganda pa sa sumpa sa kanya, nagdala siya ng ilaw tuwing gabi.

21. I am enjoying the beautiful weather.

22. The app has also become a platform for discovering new music, with songs going viral through TikTok.

23. Ano naman ang gagawin mo sa inyong hardin? wika ng binata

24. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

25. Einstein was offered the presidency of Israel in 1952, but declined the offer.

26. Dahan-dahan niyang sinalat ang baso upang hindi ito mabasag.

27. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

28. Kinabukasan ay nag paalam ulit si Ana na aalis pagtungo sa kagubatan, dahil tinawag daw siya ulit ng nagbigay ng pagkain sa kaniya.

29. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

30. Det er vigtigt at have et godt støttenetværk, når man bliver kvinde.

31. Gaano ho ba kalaking lupa ang gusto ninyo?

32. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

33. Salatin mo ang prutas para malaman kung hinog na ito.

34. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

35. Inilagay nya sa poon ang biniling sampaguita.

36. Aling hayop ang nasa tabi ng puno?

37. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

38. That'll be 4,788.50 pesos ma'am.

39. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

40. Hawak niya yung kamay ni Gelai habang palapit sa amin.

41. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

42. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

43. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

44. The beach has a variety of water sports available, from surfing to kayaking.

45. Bumibili ako ng maliit na libro.

46. Nagsimula ang programa sa dakong huli ng gabi.

47. Si Aling Juana ang tagalaba ng pamilya.

48. He was warned not to burn bridges with his current company before accepting a new job offer.

49. Hindi maikubli ang panaghoy ng bata habang nilalapatan ng lunas ang sugat niya.

50. Hoy akin yan! inagaw nya pabalik yung popcorn.

Similar Words

following,

Recent Searches

followingtandangnasilawindustriyakaratulanglahatmatumalmakapilingguideevolvemonitoredit:labahinmanagerbantulotsikatmaghapongpagsusulitmaya-mayanatitirangvariousphilanthropynagcurvepaki-drawinguusapanbabasahinmatulismalikotdefinitivoisamanamalagunaculturalpinakamatabangsalu-salokakuwentuhandragonpatakbomagkaparehonagtungoinspirasyonespecializadassalamatseryosonglagnatkapitbahaynangapatdannagsineusuarioiniirognamumulotpinapasayaluluwasnanahimikmakakawawaguerrerotahimiksistemaspagbabayadmagbaliknakikitangpalayanpedei-rechargelackdesdeheyshowbalitangpebrerokuwebamonumentomatitigasbulongkakayanannag-iisangsenioriguhitdahanmahirapbansanghopesonidomaid1787radiodreamboracaysentencebigotepinalakingreporttrueeyeclassroomauditcebulabaskaringbien1940tonightpilingtoolhimigechavepinilingenddidinggusting-gustohitsuragarbansospangalananmesangtamautosbilhanhitiknagpasamaisinagotkendisakristankinapanayammakangitikamaliannagtitindasnadumaankagandanaglulusakhistoriaisinarastreamingdeterioratenagsagawamerrybio-gas-developingmalapitanalas-dostabinginiindakaraokefilipinamoviekapasyahanmamimissmagbibiladtinawagrespektivefranciscoalagangmadalingsisipainjagiyastillnyareservesbangkopinoymaibade-latapaglalabadawaiterhagdanproductsscalegranveryzoomsukatmestduonhinilaformatthreeaplicakadaratingrobertmeanburdenpagkakatuwaanbatalansandwichberetimakakatalomakakiboartscharmingstep-by-stepmangangalakalshadeshinimas-himascancersiyudadkargahanpatawarinvedvarendemagkasakitmabatongmag-uusap