Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

2. Puwede ho ba akong lumipat ng kuwarto?

3. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

4. It can be helpful to create an outline or a mind map to organize your thoughts

5. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

6. Está claro que debemos tomar una decisión pronto.

7. Limitations can be a result of geographic location or access to resources and opportunities.

8. The basketball court is divided into two halves, with each team playing offense and defense alternately.

9. La deforestación es la pérdida de árboles y plantas en los bosques debido a la tala indiscriminada.

10. Naputol yung sentence ko kasi bigla niya akong kiniss.

11. Ang apoy sa kalan ay nagbabaga pa rin kahit patay na ang apoy.

12. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

13. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

14. Ipinabalot ko ang pakete sa kapatid ko.

15. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

16. Sa isip ko, naglalabas ako ng malalim na himutok upang maibsan ang aking kalungkutan.

17. Paglalayag sa malawak na dagat,

18. Einstein's theory of general relativity revolutionized our understanding of gravity and space-time.

19. Le jeu peut avoir des conséquences négatives sur la santé mentale et physique d'une personne, ainsi que sur ses relations et sa situation financière.

20. May lagnat, sipon at ubo si Maria.

21. Gusto ko na talaga mamasyal sa Singapore.

22. Kailangan nating bigyan ng tamang suporta at pag-unawa ang mga taong madalas mangiyak-ngiyak upang matulungan silang lumampas sa kanilang pinagdadaanan.

23. En invierno, los animales suelen hibernar para protegerse del clima frío.

24. They have won the championship three times.

25. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

26. Mag-ingat sa aso.

27. The company suffered from the actions of a culprit who leaked confidential information.

28. Gawa sa faux fur ang coat na ito.

29. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

30. Membangun hubungan yang mendalam dengan diri sendiri dan orang lain, serta merayakan momen-momen kecil, memberikan kebahagiaan yang tahan lama.

31. It’s risky to rely solely on one source of income.

32. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

33. He thought he was getting a free vacation, but I reminded him that there's no such thing as a free lunch.

34. Ipinaluto ko sa nanay ko ang pansit.

35. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

36. Ang mga dentista ay may mga kagamitan na ginagamit upang masiguro na malinis at malusog ang mga ngipin.

37. Makakasahod na rin ako, sabi niya sa sarili.

38. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

39. Einstein was offered the presidency of Israel in 1952, but declined the offer.

40. Matagal-tagal na siyang tulala, hindi niya alam kung ano ang gagawin.

41. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

42. The scientific community is working to develop sustainable energy sources to combat climate change.

43. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

44. Sige ako na ang isa pang sinungaling! Bwahahahahaha

45. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

46. Einstein's intellectual curiosity, creativity, and persistence in the face of challenges serve as a model for aspiring scientists and scholars.

47. Napakabuti nyang kaibigan.

48. Umakyat sa entablado ang mga mang-aawit nang limahan.

49. Fødslen kan også være en tid med stor frygt og usikkerhed, især for førstegangsforældre.

50. Saan nyo balak mag honeymoon?

Similar Words

following,

Recent Searches

tsonggofollowingmusicpanginoonumabotakmangtaksipeppypinatiramarangyangnahulogpangangatawanoueanaycelularesmagisingdyipeksport,jacepicsdalawaipatuloymapag-asanginterpretingsutilofferkarnabalbroadcastslayuninmetodemagkikitasinipangpinagsikapanredwhyerhvervslivetmiyerkolesopoalegotpagpilikare-karenakatapatincluirthanksgivingpagguhitmapmawalasay,nataloipagtanggolhvordanbabykaraokeanihinkuwebamarilouliv,sasayawinpaanokasomalihisgodtpagsasalitainterests,pierpepetiniocharmingbluecoatactiontrueexpertbayadnariningnakatirangninongclienteslikelyinternanamulatnanlilimahidmagdamaganmagpa-ospitalexpectationstumakbotanyagmalawaknagkakasyaselebrasyonnagpaalamlabing-siyampanghabambuhaynagwelgasinasabiihahatidbulaklakdoble-karamaabutannakapagproposetinataluntonpakikipaglabansiopaonagbagoorkidyastilgangnatinagmaestravariedaddalawinbinawianiyamotunansakimmakinanggownnasuklamkaraniwangkumapitbaduyconsumebingiadvancehigh-definitionkatagaorugacontesteffektivsinunodalexandersoccersabadchangerefersditofakeadditionkabibibroadcastingexistfencingchefenforcingeveningpantallasmagkakaanaknagpakitatatawagmagtiwalakalaroganyanunitedinastatilanakatingindapatsigabusiness,medievalcryptocurrencyboksingcalleraalislegislativeworldsalapisamainformedmamanhikannakapagreklamoginugunitasportsaanhinguitarrapronountatagalhuertogrocerynag-aabangdreamslihimbateryacreditdatikahilingantradetsaaagilityeksenafuncionarnothingmakapilingryanwaitnagpalalimkatawangkutsilyokalalaroisasabad