Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Hindi ko kinuha ang inyong pitaka.

2. Børn med særlige behov har brug for ekstra støtte og ressourcer for at trives.

3. Football coaches develop game plans and strategies to help their team succeed.

4. Bis bald! - See you soon!

5. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

6. Wag ka naman ganyan. Jacky---

7. Ang mga punong-kahoy ay kabilang sa mga pangunahing likas na yaman ng ating bansa.

8. Isasama ko ang aking mga kapatid sa pamanhikan.

9. Kapitbahay ni Armael si Juang malilimutin.

10. Nagwo-work siya sa Quezon City.

11. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

12. She has collaborated with several prominent artists, including The Weeknd, Nicki Minaj, and Lady Gaga.

13. Gusto mong makatipid? Kung gayon, iwasan mong gumastos sa mga di-kailangang bagay.

14. Sa probinsya, ang mga bukirin ay sumasalamin sa mayabong na kabuhayan ng mga magsasaka.

15. El nacimiento de un bebé es un recordatorio de la belleza de la vida.

16. Les impôts sont une source importante de revenus pour l'État.

17. Hindi ako sang-ayon sa pamamaraan na ginagamit mo upang maabot ang iyong mga layunin.

18. I am absolutely committed to making a positive change in my life.

19. Folk med en historie af afhængighed eller mentale sundhedsproblemer kan være mere tilbøjelige til at udvikle en gamblingafhængighed.

20. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

21. Pinuntahan ng pasyente ang doktor.

22. Bilang paglilinaw, ang damit na dapat isuot ay kulay puti, hindi asul.

23. Ano ang ipinabalik mo sa waiter?

24. Gaano karami ang dala mong mangga?

25. Limitations can be addressed through education, advocacy, and policy changes.

26. I received a lot of gifts on my birthday.

27. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

28. Dancing all night at the club left me feeling euphoric and full of energy.

29. Necesitamos esperar un poco más antes de cosechar las calabazas del jardín.

30. Doa dapat dilakukan oleh siapa saja, tanpa memandang agama atau keyakinan.

31. Hindi mo alam ang sagot sa tanong? Kung gayon, dapat kang mag-aral pa.

32. Pakibigay mo ang mangga sa bata.

33. Ang pagiging maramot ay salungat sa pagiging bukas-palad.

34. El perro de mi amigo es muy juguetón y siempre me hace reír.

35. Matayog ang lipad ng saranggola ni Pepe.

36. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

37. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

38. Marami pa siyang mga pangarap sa buhay at kailangan ko pa po siya.

39. Ang takip-silim ay isang magandang panahon upang magpahinga at magrelax mula sa mga pagod ng araw.

40. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

41. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

42. Kucing juga dikenal sebagai pembasmi tikus dan serangga di rumah atau tempat tinggal.

43. La Navidad y el Año Nuevo se celebran en invierno.

44. Los agricultores deben estar atentos a las fluctuaciones del mercado y la demanda de sus productos.

45. Ofte bliver helte hyldet efter deres død.

46. Hindi mo malalaman na maarte siya sa kanyang kagamitan dahil lagi itong malinis at maayos.

47. Nous avons décidé de nous marier cet été.

48. Pagdating namin dun eh walang tao.

49. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

50. Ang taong hindi marunong lumingon sa pinanggalingan, ay hindi makakarating sa paroroonan.

Similar Words

following,

Recent Searches

followingmuchnagmamadalimabalikrestaurantpinanalunanulobituinkaragatanpalaginapailalimmaglaromangyaristyrerpromisewantculturetatawagangalawmundoskyldessocialesmagalangkamatisalimentonakitapanitikan,pakakatandaanmunangenglishmusicianhimigsinagotwideamericapag-indakpinagmamalakib-bakitcompartenpa-dayagonalpicturesmaghandamagitingdoonvillagekendilumampaspeacemataposduwendeentresubject,gisingcontenthabitnakasahodkagabinatupadwealthislandfarmsupilinaanhinnag-uumirihamakshoppingbooksmahiligimagesgratificante,pagmamaneholupasuccessbuhokseguridaddekorasyonpakaininmarahilsumungawmulti-billionwalabusabusinipinambilibuslonalalagasnagtutulunganmalapitgupitpadalaskabundukangameslimitedkasamamagbagobokmaintainnasrequirestatestenhumanslegitimate,basketbolmagturoamparowednesdayngunitcover,magpapaligoyligoywashingtonguropagluluksamagta-trabahojeepneyyataipaliwanagnanaogumilingnamanghapalancamediagandaanyoejecutanmessagelibanganbanaloftepinauwi1960spinipilitmadalidraft,reviewmulingkaratulanghelekayaipinanganakkumanannegosyantenaabutanasobakapatientginamitnakaramdamshouldpamilyangnakaakyatnalagutanewannag-alalabinatanadadamaymaghahatidjobreachpaosicontataasmakapangyarihanggawapakpakseenpneumoniasangkalanmedya-agwapinangaralannakabluemeaningnakapaligidhinabimabaitbumotoexamplelabaskurakotmatandaonline,baku-bakongkikocommunicatengipingeroplanoyoungsakeniniinomnabitawanbagongmagkasintahanmagbibigaymakalapitlabing-siyamchangehonestoarghipaliniskadalasika-50