Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "following"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. All these years, I have been chasing my passions and following my heart.

3. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. I've been following the diet plan for a week, and so far so good.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. In the years following his death, Presley's legacy has continued to grow

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

2. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

3. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

4. Nagpamasahe siya sa Island Spa.

5. We need to reassess the value of our acquired assets.

6. Libag ang tawag sa duming kumakapit sa katawan na karaniwang galing sa alikabok

7. Oo naman 'My! Walang hihigit pa sa Beauty ko noh.

8. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

9. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

10. Sa tuwing nakikita kita, nadarama ko na may gusto ako sa iyo.

11. Sa kanyang paglalakad sa kahabaan ng dagat, napadungaw siya sa malalaking alon at namangha sa kanilang ganda.

12. Paglalayag sa malawak na dagat,

13. He's always the first one in the office because he believes in the early bird gets the worm.

14. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

15. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

16. Los trabajadores agrícolas se encargan de cosechar los campos a mano.

17. Ganun talaga. Simpleng sagot ko.

18. The team lost their momentum after a player got injured.

19. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

20. Pinili ng mga magulang ang pinakamalapit na paaralan sa kanilang tahanan upang hindi na mahirapan ang mga bata sa pagbiyahe patungong silid-aralan.

21. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

22. Making large purchases without consulting your budget is a risky move.

23. Naglalaro sa isip niya na ngayong napakalakas ng ulan lalo siyang magtataas ng presyo.

24. Facebook offers targeted advertising options for businesses and organizations to reach specific audiences.

25. Doa juga bisa dianggap sebagai bentuk ungkapan syukur atas nikmat dan karunia yang diberikan Tuhan.

26. The grocery store offers a variety of fresh produce, including fruits and vegetables.

27. Dapat natin itong ipagtanggol.

28. The United States is the world's largest economy and a global economic superpower.

29. El arte puede ser interpretado de diferentes maneras por diferentes personas.

30. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

31. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

32. Masdan mo ang aking mata.

33. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

34. Nagsmile siya sa akin at ipinikit niya ulit yung mata niya.

35. Saan ho ba ang papuntang Manila Hotel?

36. Tapos nag lakad na siya papunta sa may kotse.

37. El diseño inusual del edificio está llamando la atención de los arquitectos.

38. Ayaw kong pag-isipan ang sinabi mo.

39. Ang pagiging hospitable ay likas na katangian ng mga Pinoy.

40. May dalawang kotse sina Dolly at Joe.

41. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

42. Napapagod ako sa bigat ng poot na umaabot sa aking kalooban.

43. Lumbay na naman si Jose matapos matalo sa sabong.

44. Wala ka namang dapat ipag-alala. Kaya ko ang sarili ko.

45. She is not designing a new website this week.

46. Hindi ako mahilig kumain ng pulotgata dahil sa sobrang tamis nito.

47. Las heridas en la cara o cerca de los ojos deben ser evaluadas y tratadas por un especialista en oftalmología.

48. Sa gitna ng pagdidilim, napansin ko ang nagliliwanag na ilaw mula sa aking bahay.

49. La tos puede ser un síntoma de cáncer de pulmón.

50. Wag kang mag-alala.

Similar Words

following,

Recent Searches

telefonpinapasayafollowinggenerositytrycyclesagapguidelumulusobnababalotquicklydividesaccederbehalflulusogtumagalinaabutanvictoriaracialpackagingreachnamanshadesfilipinaofte1970snakuhangmariloupatuloglumipattataymag-aralnagpakitalayawpagngitimatagumpayonlylumiwagnabalitaanrenacentistamabaitpisnginagawangtraditionaltelephonetinungode-latanilalangnalakiagostofreedomsiniindaturonlubosbarcelonadalawabulongredesnakapagngangalitmagnangapatdannagbungahimpamahalaanwidenagyayangapologeticpasaheromagtigilmaipagmamalakingnovellestalagamaipapautangkuneliv,sampaguitaiilanhalamananhundredsidonyebipolartangeksshowgamitininfluencesatacomunicanalituntuninbinuksantuyobarriersorganizepaliparinlalakemisahigitibinaonasokapataganbinatangpoorertabigalaknapabalikwaspagiisipunobinigyangpaanonginiwanrespektivenalugodkumakantaanaynamumukod-tangiaddictioncigaretteakingmadungiskasalvaledictoriannothingsumamamagdapagtutoliikotparusangbilerartssteamshipskalakihanrosaumiyakpuntajohnpaakyatdisfrutardali-dalipookminamahalkilocornerkaarawankumikilosmakespedemakatigabeiwasankayolaliminilabasnaglokohannapahintotagalogitimnakapikitnaglabananpulubiandamingkwebangmakakakaentabingburdenpatakbonggayunpamanmababangisnasasaktanbiliculturaipinaabrilpagtawanakaraankakutisdipangdinmainitagam-agambumotowarigaanotumalonkesosamahanmakakawawaconectadosedadnakabaoneleksyonperpektomalumbaydiliginchildrenpasanglatetelangseriousnapabayaanipaghugaskinapanayam