Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "company"

1. A portion of the company's profits is allocated for charitable activities every year.

2. Amazon is an American multinational technology company.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

5. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

8. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

9. Na-promote ako sa higher position sa aking company kaya masayang-masaya ako ngayon.

10. Tesla is an American electric vehicle and clean energy company.

11. The acquired assets have already started to generate revenue for the company.

12. The acquired assets were carefully selected to meet the company's strategic goals.

13. The acquired assets were key to the company's diversification strategy.

14. The acquired assets will be a valuable addition to the company's portfolio.

15. The acquired assets will give the company a competitive edge.

16. The acquired assets will improve the company's financial performance.

17. The CEO received a hefty bonus for successfully leading the company through a period of growth.

18. The company acquired assets worth millions of dollars last year.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company decided to avoid the risky venture and focus on safer options.

21. The company had to cut costs, and therefore several employees were let go.

22. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

23. The company is exploring new opportunities to acquire assets.

24. The company launched a series of new products, targeting different customer segments.

25. The company lost a lot of money by cutting corners on product quality.

26. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

27. The company suffered from the actions of a culprit who leaked confidential information.

28. The company used the acquired assets to upgrade its technology.

29. The company's acquisition of new assets was a strategic move.

30. The company's acquisition of new assets will help it expand its global presence.

31. The company's board of directors approved the acquisition of new assets.

32. The company's CEO announced plans to acquire more assets in the coming years.

33. The company's financial statement showed an increase in acquired assets.

34. The company's growth strategy is focused on acquiring more assets.

35. The company's losses were due to the actions of a culprit who had been stealing supplies.

36. The company's profits took a hefty hit after the economic downturn.

37. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

38. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

39. The culprit behind the data breach was able to exploit a weakness in the company's security.

40. The elephant in the room is that the company is losing money, and we need to come up with a solution.

41. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

42. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

43. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

44. They admire the way their boss manages the company with fairness and efficiency.

Random Sentences

1. Aba'y lintek na babaeng ito! Ang langis mo! Paano na ako magugustuhan ni Pedro nyan! ani ni Ipong sabay hawi ng buhok.

2. Mawala ka sa 'king piling.

3. The singer's performance was so good that it left the audience feeling euphoric.

4. Nagtawanan kaming lahat sa hinirit ni Kenji.

5. Si Juan ay napakagaling mag drawing.

6. La música es una forma de arte que se disfruta en todo el mundo.

7. Ano ang ginagawa niya sa gabi?)

8. Nous avons opté pour une cérémonie de mariage intime.

9. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

10. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

11. Mahalaga ang listahan para sa mga malilimutin tulad ni Lita.

12. Pigilan nyo ako. Sasapakin ko talaga 'tong isang 'to.

13. The love that a mother has for her child is immeasurable.

14. Ang taong lulong sa droga, ay walang pag-asa.

15. Ang daming kuto ng batang yon.

16. Namiss kita eh. Sabay ngiti ko sa kanya.

17. Durante las vacaciones, me gusta relajarme en la playa.

18. Emphasis can help to ensure that a message is received and understood by the intended audience.

19. Napapaisip ako kung ano pa ang mga magagandang paraan upang mapaligaya ang aking nililigawan.

20. Orang tua bayi sering kali merayakan hari ulang tahun anak mereka setiap tahunnya dengan acara yang meriah.

21. Anong nakakatawa? sabay naming tinanong ni Sara

22. Maaliwalas ang paligid sa bukid tuwing madaling araw

23. We have been painting the room for hours.

24. Saan pupunta si Trina sa Oktubre?

25. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

26. Ang paggawa ng sining tulad ng pagpipinta o pagguhit ay isang nakagagamot na paraan upang maipahayag ang aking damdamin.

27. Vi skal fejre vores helte og takke dem for deres indsats.

28. She speaks three languages fluently.

29. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

30. May meeting ako sa opisina kahapon.

31. Walang mangyayari satin kung hindi tayo kikilos.

32. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

33. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

34. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

35. They do yoga in the park.

36. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

37. El acceso al agua potable es un derecho humano fundamental.

38. Juan siempre espera el verano para cosechar frutas del huerto de su abuela.

39. Libro ko ang kulay itim na libro.

40. Ang bato ay hindi mahuhulog kung walang sisidlan.

41. Ipinakita nya ang determinasyon sa larangan ng boxing.

42. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

43. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

44. Aaissh! biglang upo si Maico pagka-maktol.

45. Habang naglalakad ako sa dalampasigan, natatanaw ko ang malalaking alon na dumadampi sa baybayin.

46. Get your act together

47. Nakagagamot ng diyabetis ang halamang ito.

48. Kanina pa kami nagsisihan dito.

49. Sa aking kasintahan, natatanaw ko ang pagmamahal na umaapaw sa kanyang mga mata.

50. Los héroes son capaces de cambiar el curso de la historia con sus acciones valientes.

Recent Searches

ipinatawagintindihincompanykaliwangkaklasenaghihiraptahananpinigilaninakalangumingisiabut-abotlumilipadsabihinpwedengnangangakonagdadasalperwisyonovemberkaliwaibaliksamakatuwidsakimgusalidiyosnoblecarmenkangitanempresassiyudadpadalastextosalaminpatawaringawaingtrentanaritosamantalangmanakbomagisipdiyosangiyamothelenanahigitanbinentahanvedvarendetumatawadkailanmantilgangnagbagopicturespaketeuniversitydiyosaumabotnaghilamosmuchoslandemaabutancarlonatinagcruzmathtaosmagsungitpinauwibumabakuwentokapintasangmarketingintramurosnapakabilistennisnatabunanpatakboayokogiyeranakahaindalanghurtigereestasyonedukasyoninilagaykatagapinalalayaspamanbalotdagat-dagatanilagaynabagalantoolspalakadagatmorenamatesalalakibagalbinasamatabaannikaartisttignanisipinblusadalagakanilaibabasilyaanilalunasparurusahannapakasipagperformanceginaganapmangkukulammagpakaraminagdiriwangtransportationpamimilhingnapapasabayganapmakinghopetrafficnangalaglagnagtaaskrustrennearbutoganakikotaasentry:lupangnoonjoeproducts:naawapara-parangoponewspapersdividespapayakaraokekirotnangampanyakoreanbundokkinayapaalamninatalentmangoperahanpanatilihinbigyanmakikipagsayawnapadpadmakisuyokumainctricasmisyunerongnagpasanisasamapinaulanannaglulusakpakibigyansakalingconvey,nakabaonikatlongisdangtawananasahangowncaraballopangalanannakabiladhihigitmasukolpananakitpagpalitmakausaptiniklingvariedaditinulosninyongroofstocknapatingininisipkasabaykumapitkubonapadaanmaongtanawsellingrepublicanlagaslaspalitan