Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "company"

1. A portion of the company's profits is allocated for charitable activities every year.

2. Amazon is an American multinational technology company.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

5. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

8. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

9. Na-promote ako sa higher position sa aking company kaya masayang-masaya ako ngayon.

10. Tesla is an American electric vehicle and clean energy company.

11. The acquired assets have already started to generate revenue for the company.

12. The acquired assets were carefully selected to meet the company's strategic goals.

13. The acquired assets were key to the company's diversification strategy.

14. The acquired assets will be a valuable addition to the company's portfolio.

15. The acquired assets will give the company a competitive edge.

16. The acquired assets will improve the company's financial performance.

17. The CEO received a hefty bonus for successfully leading the company through a period of growth.

18. The company acquired assets worth millions of dollars last year.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company decided to avoid the risky venture and focus on safer options.

21. The company had to cut costs, and therefore several employees were let go.

22. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

23. The company is exploring new opportunities to acquire assets.

24. The company launched a series of new products, targeting different customer segments.

25. The company lost a lot of money by cutting corners on product quality.

26. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

27. The company suffered from the actions of a culprit who leaked confidential information.

28. The company used the acquired assets to upgrade its technology.

29. The company's acquisition of new assets was a strategic move.

30. The company's acquisition of new assets will help it expand its global presence.

31. The company's board of directors approved the acquisition of new assets.

32. The company's CEO announced plans to acquire more assets in the coming years.

33. The company's financial statement showed an increase in acquired assets.

34. The company's growth strategy is focused on acquiring more assets.

35. The company's losses were due to the actions of a culprit who had been stealing supplies.

36. The company's profits took a hefty hit after the economic downturn.

37. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

38. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

39. The culprit behind the data breach was able to exploit a weakness in the company's security.

40. The elephant in the room is that the company is losing money, and we need to come up with a solution.

41. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

42. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

43. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

44. They admire the way their boss manages the company with fairness and efficiency.

Random Sentences

1. Di ko sya maistorbo dahil sya ay nag-aaral pa.

2. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

3. Nagsmile siya sa akin, Bilib ka na ba sa akin?

4. Ang taong lulong sa droga ay parang nasa bangin na patuloy na bumababa hanggang sa wala na siyang mahawakan.

5. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

6. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

7. Ang kaniyang galak ay animo'y nakakahawa, nagbibigay saya sa lahat ng nakapaligid.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. Mahalaga sa akin na mapaligaya ang aking nililigawan kahit sa maliliit na bagay lamang.

10. Ang siko ng bata at tumama sa kanyang kaliwang dibdib.

11. The task of organizing the event was quite hefty, but we managed to pull it off.

12. Ang kanilang kaharian ay malapit sa isang maliit na gubat na kung saan ay malayang nakakapamasyal ang mayuming kagandahan.

13. Nagbiyahe ako sa Mindanao noong isang taon.

14. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

15. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

16. Natawa nanaman sya, Hindi, maganda sya.

17. Bigla siyang bumaligtad.

18. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

19. Mabuti naman at bumalik na ang internet!

20. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

21. Bakso adalah bola daging yang disajikan dengan mie dan kuah kaldu.

22. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

23. Napangiti ang babae at umiling ito.

24. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

25. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

26. Taking a vacation to a beautiful location can create a sense of euphoria and relaxation.

27. Ang kamalayan sa kanyang pangalan at nagawa ay naging inspirasyon para sa maraming henerasyon ng mga Pilipino.

28. Dahan dahan kaming nag lakad. Papapunta sa may.. Sigh.

29. Akin na cellphone mo. paguutos nya.

30. Nakapila ako sa bayad center upang magbayad ng kuryente.

31. La creatividad es esencial para el progreso y el avance en cualquier campo de la vida.

32. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

33. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

34. You got it all You got it all You got it all

35.

36. Dogs are social animals and require attention and interaction from their owners.

37. Medarbejdere kan skifte karriere når som helst i deres liv.

38. Maaari po bang makahingi ng sobra sa hapunan ninyo?

39. Ang magnanakaw ay kumaripas ng takbo nang mabisto ng tindera.

40. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

41. Tangan ang sinipang pigi, ang buong anyo ng nakaangat niyang mukha'y larawan ng matinding sakit.

42. Masayang kasayaw ng mga Kuneho ang mga Usa, ng mga Elepante ang mga Tamaraw, ng Zebra ang Tsonggo.

43. Ang mga bata ay nagtatanim ng mga buto upang makita ang proseso ng paglaki ng mga halaman.

44. Naawa naman ang pamilya kay Damaso, kaya doon na pinatira sa bahay nila ito.

45. Have you been to the new restaurant in town?

46. Humarap siya sa akin tapos nag smile.

47. Bago umalis ng bahay, isinasagawa niya ang ritwal ng pagdarasal upang maging ligtas sa biyahe.

48. The early bird catches the worm.

49. Mabilis siyang natutunan ang mga bagong teknolohiya dahil sa kanyang natural na abilidad sa kompyuter.

50. may butil na rin ng pawis sa kanyang ilong.

Recent Searches

ipinatawagcompanyjejularuindasalnagbabasakakilalaguerrerotienenpapalapitkapatagankailanmanculturesnaguusaprodonahagdanankasuutannapapatinginpulitikoeksportenannikapinilitmaibabalikmawalabibilivegasundeniablefreedomskirbyakmangtindahanmaskinermagpakaramipasasalamatlintamadurasmaulitasohinigitpepeipinasyangnasanpogicrossbalatlilypeppyandresmasaraptulangmalapitansocialemaongusasenateespigaspitolosshidingyepmakaratingkabosessorespeechestryghedmisacomienzanbernardomesangterminosansisipainlakadnalasingtransparentdahonspecializedprovidemalinismemorialtools,amongbitawantalestudiedbehalfdaratinghelpfultuwidshapingdennanlilisikflashbilaoinnovationnagpakitahubad-baropamamasyalinirapanginawaranconditionmansanasmangingisdangpasahesuriingasmenpambansanglugawpapapuntanapawipagdamiareaexhaustedmedievaleffektivginagawalastinglibrepracticadosalapiugalikaninamakapasanaawaimikkaniyakonsultasyonhitsuratumawagnapapalibutanfotosisinulatobserverernahulinanghihinamadnagtatrabahotinatawagsaranggolanakatunghaynageenglisheskuwelahanisasabadnag-iimbitasasagutinsakristannagliwanagpinagkiskismahahanaynakadapamagkasabaylinggongkalakimakatuloginvestnovellesuugud-ugodmakakakaenkatuladkontratatindabobdesisyonannangyarimagsugalmasakitnapatulalayumabangdyipnisiyamagkaibangconservatoriosstatebulalasnahahalinhancruzmanilbihanculturaskapintasangdispositivomusicalestagumpaytsonggopaliparinmagisipkastilangmagawakesohiwagareynagaanokulisaphunibarongarturomartiandisciplinpublicationiigibteacherinfluences