Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

44 sentences found for "company"

1. A portion of the company's profits is allocated for charitable activities every year.

2. Amazon is an American multinational technology company.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

5. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

8. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

9. Na-promote ako sa higher position sa aking company kaya masayang-masaya ako ngayon.

10. Tesla is an American electric vehicle and clean energy company.

11. The acquired assets have already started to generate revenue for the company.

12. The acquired assets were carefully selected to meet the company's strategic goals.

13. The acquired assets were key to the company's diversification strategy.

14. The acquired assets will be a valuable addition to the company's portfolio.

15. The acquired assets will give the company a competitive edge.

16. The acquired assets will improve the company's financial performance.

17. The CEO received a hefty bonus for successfully leading the company through a period of growth.

18. The company acquired assets worth millions of dollars last year.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company decided to avoid the risky venture and focus on safer options.

21. The company had to cut costs, and therefore several employees were let go.

22. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

23. The company is exploring new opportunities to acquire assets.

24. The company launched a series of new products, targeting different customer segments.

25. The company lost a lot of money by cutting corners on product quality.

26. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

27. The company suffered from the actions of a culprit who leaked confidential information.

28. The company used the acquired assets to upgrade its technology.

29. The company's acquisition of new assets was a strategic move.

30. The company's acquisition of new assets will help it expand its global presence.

31. The company's board of directors approved the acquisition of new assets.

32. The company's CEO announced plans to acquire more assets in the coming years.

33. The company's financial statement showed an increase in acquired assets.

34. The company's growth strategy is focused on acquiring more assets.

35. The company's losses were due to the actions of a culprit who had been stealing supplies.

36. The company's profits took a hefty hit after the economic downturn.

37. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

38. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

39. The culprit behind the data breach was able to exploit a weakness in the company's security.

40. The elephant in the room is that the company is losing money, and we need to come up with a solution.

41. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

42. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

43. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

44. They admire the way their boss manages the company with fairness and efficiency.

Random Sentences

1. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

2. Ang kamalayan sa mga isyu ng karapatang pantao ay nagpapabukas ng pinto sa pagtugon sa mga pangangailangan ng mga mahihirap.

3. Det er en metodisk tilgang til at forstå verden omkring os og finde årsager til de fænomener, vi observerer

4. The professional athlete signed a hefty contract with the team.

5. The character in the movie was content in his simple life, believing that ignorance is bliss.

6. Mas maganda tingnan ang mga bulaklak sa dapit-hapon dahil kakaiba ang ilaw ng araw.

7. Salamat na lang.

8. Binilhan ko ng kurbata ang tatay ko.

9. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

10. He has been practicing the guitar for three hours.

11. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

12. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

13. Ay shet. Ano ba yun natanong ko. Biglaan.

14. She joined a charitable club that focuses on helping the elderly.

15. Mahal ko ang pusa ko dahil malambing siya.

16. Bawal magpakalat ng mga labis na pamahiin dahil ito ay nagdudulot ng takot at kawalan ng kaalaman.

17. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

18. Hinahangaan siya ng marami dahil sa kanyang pagiging mapagkumbaba kahit galing siya sa mababa na estado ng buhay.

19. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

20. Masakit mang tanggapin, sa pamilya pa rin ang tatak ng iyong pagkatao.

21. Mabini ang sumulat ng konstitusyon ng unang Republika ng Pilipinas.

22. Ang huni ng mga Kuliglig at kokak ng mga Palaka ay sumasaliw sa awit ng mga Maya.

23. Ang kamalayan sa kanyang pangalan at nagawa ay naging inspirasyon para sa maraming henerasyon ng mga Pilipino.

24. Kumain na tayo ng tanghalian.

25. Eating healthy is an important way to take care of your body and improve your quality of life.

26. Hinugot ko ang papel sa loob ng envelope.

27. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

28. Nagsisilbi siya bilang security guard upang protektahan ang mga tao at ari-arian.

29. Lumalakad siya ngayon na walang-tiyak na patutunguhan.

30. Hindi maganda ang kanilang plano kaya ako ay tumututol dito.

31. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

32. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

33. Kumusta ho ang pangangatawan niya?

34. J'ai acheté un nouveau sac à main aujourd'hui.

35. Ang tag-ulan ay kadalasang panahon ng pagtatanim ng mga halaman at tanim dahil sa malakas na pag-ulan.

36. Kumusta? Ako si Pedro Santos.

37. Paano magluto ng adobo si Tinay?

38. Nakakapagod din palang maging nag-iisa sa paglalakbay.

39. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

40. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

41. The momentum of the economy slowed down due to a global recession.

42. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng lakas at inspirasyon sa akin.

43. They are not attending the meeting this afternoon.

44. Sino-sino ang mga inimbita ninyo para manood?

45. She complained about the noisy traffic outside her apartment.

46. Puwede paki-ulit ang sinabi mo?

47. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

48. Emphasis can be used to create a sense of drama or suspense.

49. Naisip nilang tinangka ng kanilang anak na sunugin ang kanilang bahay.

50. Opo. Ano pong kulay ang gusto ninyo?

Recent Searches

naglarocompanysugataninuulampahabolpapuntangiba-ibangnagtuturokuligligbihiracynthianuevosarongnakaliliyonginabutantiyandustpanperwisyoinfectioustaasmalamanghmmmbituinbingbingtabing-dagatsalatmangtodosubjectmaalogcubamalagoteleviewingbalingbadlorenaelectronicabstainingnutrientesitimipagtimplawhyhatinglabananmag-aaralmagpa-checkupnaninirahannapakagandangnagagandahannakakatulongpinagmamalakikasalukuyannagkitanangagsipagkantahanmaipantawid-gutomnagkapilatkarunungannapakagagandanagsagawabuung-buocultivapaglalaitnagsisigawpagkuwanapakahusaynapaluhaespecializadasnagbiyayapinagpatuloymerlindapangungutyakagandahagpaghaliknangyarinaiilangdyipnitumirakuryentemaulinigansinaliksikricamakikitulogpaki-ulitmakukulaypinagawanaapektuhantanggalinmawawalatitarequierenkundimannakainnatitirangcruzlumagoisinaboypundidotumatawadpaninigasnapakabilispagtatakahawlaskirtfavornaghilamosmaya-mayainagawhawaiimarasiganpaghanganapatigillalabhanitinatapatporcantidadtamarawkargahaninlovepantalonlansanganperyahannapilianilakapalcandidatesvariedadagostoninabawatbunutanminahanmahigpitmalilimutanlaganapsahodbihasaboyfriendkanayangvideomamarilbarangayganuncalidadmagdaanmagdugtongadmirednagdaosgownomfattendekatulongannikamarielkundikuboarabiainnovationcompletamentepumasokdonde1950sprimerasmariloutakotmagsaingtamadkutsilyobagamacocktailpagbabagong-anyonahulogalmacenarpalibhasabulonggreatlybutasdadalosandalinggulangbiyassabogkasuutanatensyonipinamilibumuhossmilekenjiknowssurroundingsprosesodespuespersonminamasdanmadalingbisikletamatikmanbumalikmedikalhasrestinalis