Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "birds"

1. A lot of birds were chirping in the trees, signaling the start of spring.

2. Hello love birds! bati ko sa kanila nang makalapit ako.

3. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

4. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

5. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

6. Kill two birds with one stone

7. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

8. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

9. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

10. The birds are chirping outside.

11. The birds are not singing this morning.

12. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

13. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

14. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

15. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Maglalaro ako ng tennis. Ikaw?

2. Ang marahas na paggamit ng teknolohiya, tulad ng cyberbullying, ay dapat itigil at parusahan.

3. She donated a significant amount to a charitable organization for cancer research.

4. Kailan siya nagtapos ng high school

5. Magkano ito?

6. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

7. Mahal niya pa rin kaya si Lana?

8. Maraming iba-ibang kulay na ilaw sa parke.

9. Det har også skabt nye muligheder for erhvervslivet og ændret måden, vi arbejder og producerer ting

10. Marahil ay hindi mo muna dapat gamitin ang pera mo sa pagbili ng bagong gadget.

11. Layuan mo ang aking anak!

12. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

13. Baro't saya ang isusuot ni Lily.

14. Claro, estaré allí a las 5 p.m.

15. Wala na naman kami internet!

16. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

17. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

18. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

19. Sa mga basurahan, naglipana ang mga langaw na nagiging sagabal sa kalinisan.

20. Trapik kaya naglakad na lang kami.

21. Ang biglang pagkakaroon ng mga protesta ay binulabog ang kapayapaan ng lungsod.

22. Andyan kana naman.

23. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

24. Matagal ko na syang kaibigan sa Facebook.

25. Umingit ang sahig ng kanilang barungbarong nang siya'y pumasok.

26. Sila ang mga tunay na tagapagtanggol ng kalayaan at karapatan ng mamamayan.

27. Mahilig kang magbasa? Kung gayon, baka magustuhan mo ang bagong librong ito.

28. Pinapagulong ko sa asukal ang kamias.

29. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

30. Tengo muchos amigos en mi clase de español.

31. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

32. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

33. You reap what you sow.

34. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

35. Nagliliyab ang kandila sa altar habang nagsasagawa ng dasal.

36. Kaninang umaga ay bumigay na ng tuluyan ang kanyang katawan, wala ng nagawa ang mga doktor.

37. Nag-usap kami kamakalawa ng tanghali.

38. Puwede bang pahiram ng asukal? Magluluto ako ng cake mamaya.

39. Sino ang susundo sa amin sa airport?

40. Joshua, kumusta ang pakiramdam mo?

41. Ang kotseng nasira ay kotse ni Jack.

42. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

43. Sinubukan kong magpakilig sa aking nililigawan sa pamamagitan ng pagkanta ng isang love song.

44. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

45. Ako ang mas nagulat nang hapasin ni Maico sa hita si Mica.

46. Ang pagdarasal o meditasyon ay nakagagamot sa aking kalooban at nagbibigay ng kapayapaan.

47. Omelettes are a popular choice for those following a low-carb or high-protein diet.

48. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

49. Sa lahat ng bagay, mahalaga ang tamang panahon.

50. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

Recent Searches

probinsyabirdskamatislabiskarapatangbusiness:instrumentalgawaingmatumalkainitanafternoonnanamantrentanagdalalumindolsinehannagbagoestudiotilgangminatamismarielpaosretirarlaamangbenefitsgumisingkirbyumupochristmasinhalemagalitmaskinerumiwaspapayaguerrero1970spagkabuhaydeterminasyonkuwebatinitindananaybestidamasipaglaruannararapatpamamahingabilanginwednesdaylalongpakisabipelikulaphilosophicalhinabolskillluisditocondoconventionalltomatuliskanandaanparurusahankarangalanpamimilhingyanrichmapuputi18thkatagaimagesyunjustnogensindebuwalnetflixherramientaspecialagasitawumaliskulangfertilizertingtssssolarblusangokaywereparosuotutilizalalahaygranadalaropongmagtipideksperimenteringassociationhappenedlegacyperoiniinomleukemiaklimalasingeromatchingwalissumamacomienzanwalangjokeproperlykatabingkabibinatanggapcontent,eliteeventscommunicatemaputiechavebeforemichaeltiyadaigdigtrueshockpromotinggenerationergraceinuminilankaibigansigloiligtasnausaldatabituinsequeeffecttypesneedsbroadcastingbackseparationnegativeuniqueextrabroadcastsfourrepresentedappikinatatakotmayroongdagatkinabubuhayexpertiseactionnilalangusedmahahanaylalakisandalianilatawadpagkuwannapakaningningnaglutomaghintayyorknagmistulangnatatawahudyatumiiyaknapakabilisarbejdersisterhusogalitlumiwanagputihelpful1960smalilimutanpaghaharutanitinalagangmalalakiaddresskarnabalwastonababakaspagodtuklaskaragatanparusahannatingalaomgprogramming,