Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "hulihan"

1. Hindi dapat basta-basta magpautang ng pera dahil ito ay maaaring magdulot ng problema sa kahuli-hulihan.

2. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

Random Sentences

1. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

2. The culprit behind the product recall was found to be a manufacturing defect.

3. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

4. Oh! What a coincidence, dito ka pala nagtatrabaho?

5. She prepares breakfast for the family.

6. Ese vestido rojo te está llamando la atención.

7. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

8. Nais ko sanang sabihin sa iyo na may gusto ako sa iyo nang mas maaga pa.

9. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

10. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

11. Ang kotseng nasira ay kotse ni Jack.

12. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

13. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

14. Los héroes son capaces de cambiar el curso de la historia con sus acciones valientes.

15. Hinde na ko nag dalawang isip pang lapitan sila.

16. Nagtaka ito sa pagbabagong-anyo ni Kiko hanggang maging maliit na hayop na animo'y bayawak.

17. She admires the philanthropy work of the famous billionaire.

18. Bumili kami ng isang piling ng saging.

19. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

20. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

21. Namnamin mo ang bawat subo ng masarap na ulam.

22. Madalas na naglalaman ito ng mga konsepto at ideya na mahirap intindihin o masalimuot.

23. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

24. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

25. Sí, claro, puedo esperar unos minutos más.

26. Work is a necessary part of life for many people.

27. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

28. Halos gawin na siyang prinsesa ng mga ito.

29. Pakibigay na lang sa kanya ang sukli para hindi na siya bumalik pa.

30. Siguro nga isa lang akong rebound.

31. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

32. Kailangan ko umakyat sa room ko.

33. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

34. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

35. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

36. Kailan niyo naman balak magpakasal?

37. The wedding ceremony usually takes place in a church or other religious setting.

38. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

39. The company used the acquired assets to upgrade its technology.

40. Ang nakita niya'y pangingimi.

41. Napagkasunduan ng grupo na i-expel ang miyembro na na-suway sa kanilang code of conduct.

42. The company lost a lot of money by cutting corners on product quality.

43. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

44. Huminga ka ng malalim at tayo'y lalarga na.

45. She complained about the noisy traffic outside her apartment.

46. Makisuyo po!

47. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

48. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

49. Ayon sa doktrina ng Simbahang Katoliko, ang purgatoryo ay isang lugar kung saan ang mga kaluluwa ay nag-aayos bago pumasok sa langit.

50. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

Recent Searches

hulihanlot,nai-diallalabhanmaibibigayaga-agajejudumadatingnahintakutankabighahumihingihinalungkatnaantigpantalonmatumalsarisaringkainitanbayadkangitantinatanongnapilibinentahantig-bebeintemasaganangsuelomartianpayongcitybibilivegassikatniyangrocerynanigaspadalasnatatanawasukalpanunuksoeroplanoimbeshinaboltigasnapakonochemadalingpulitikohumpaymaubosumibigallekaniyatodaslinaligaligresortgivepalapittoretesolarpangitcinemustpaghingitillscottishbinasatshirtbotantepabalangzoosumasambatenderklimaabalabumahaelitereadersspentsinunodgearadversesyaweddingmerryradio1787richpowerhallyessaringmaaringbiromajorroboticmarchmeetadditiontanimbientryghedvideocaseswebsiteinternalipihitarmedventa1982binabaworkdayhoweverdoonlcdpopulationvisinvitationplatformsenforcinglayout,additionallyhaddonetuwidshocktabaspanguloagoschessakochangewatchrefersprogresseffectcontinuetableguidewhetherreturnedtwoinaapiandreeditorroughnakakagalingnutspilingskillinvolvekasalukuyanideyajosefamississippinanghahapdifidelkitabusogmakuhangiwinasiwaspangarapinstrumentalguerreroayokopinsanbotoincitamentermaskinernangingitngitrobinhoodnalalabikasipinisiltiniklingkamotesinalansanlaamangjennykailanjacesumisilipditoyoutubesitawespigaspakelamnagkakasayahanplanleukemiaevilrawfitnesslalakinovellesnagkakakainnapanoodpagpapakilalakabuntisanpagkatakotkinikita