Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "forskel"

1. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

2. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

3. En af de mest synlige områder, hvor teknologi har gjort en stor forskel, er i elektronik

4. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

5. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

6. Vi kan alle være helte i vores eget liv og gøre en forskel for andre.

Random Sentences

1. Nangahas siyang tumulong sa biktima ng aksidente kahit wala siyang kaalaman sa first aid.

2. He has been to Paris three times.

3. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

4. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

5. Agad na natuyo ang dugo hanggang sa naging abo ito at humalo sa lupa.

6. Facebook offers targeted advertising options for businesses and organizations to reach specific audiences.

7. Ano ang pinag-aaralan ni Cora?

8. Kumunot lang ang noo ko, That's not my name.

9. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

10. Mabuti na lang at hindi ako nauntog sa bubong ng dyip.

11. Nous avons décidé de nous marier cet été.

12. A couple of phone calls and emails later, I finally got the information I needed.

13. Hanggang sa dulo ng mundo.

14. Ang pagiging malilimutin ni Leah ay dala ng labis na pagkaabala sa trabaho.

15. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

16. Palayo nang palayo ang barko habang papalubog ang araw.

17. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

18. Nagpalipad ng saranggola si Juan sa bukirin.

19. He is running in the park.

20. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

21. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

22. Nahuli na ang salarin sa kasong pagnanakaw.

23. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

24. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

25. Haha! Bakit masama bang makidalo sa ball ng ibang school?

26. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

27. Kapitbahay ni Armael si Juang malilimutin.

28. Pumunta si Trina sa New York sa Abril.

29. Una mala conciencia puede llevarnos a tomar malas decisiones.

30. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

31. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

32. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

33. Ang galing nyang mag bake ng cake!

34. Ang mga magulang niya ay pinagsisikapan ang magandang kinabukasan ng kanilang mga anak.

35. Ngumiti muna siya sa akin saka sumagot.

36. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

37. Budgeting, saving, and investing are important aspects of money management.

38. The uncertainty surrounding the new policy has caused confusion among the employees.

39. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

40. Ano hong pitaka? ang sabi ng bata.

41. Ang aming pagsasama bilang magkabilang kabiyak ay puno ng pagpapahalaga at respeto sa isa't isa.

42. Ngunit marumi sila sa kanilang kapaligiran.

43. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

44. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

45. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

46. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

47. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

48. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

49. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

50. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

Similar Words

forskelligeforskel,

Recent Searches

kaybilisforskelpnilitnatitiranaiwangtiliasawagownkapaltataasmaibabalikhumigakinainmayabangaircondibamatataloherramientaayokoanihinwastelilyskyldesorganizesilyatinitindatsuperpinagkasundodesarrollarejecutanmayamanghagdantinanggapmerryeffektivsangvehiclestapatlendingtransmitidastransmitssigakatedralpriestmukazoobingonakatingingiconickumembut-kembotkapangyarihanhumpayzoommisusedlangkayfertilizernagbungabuwankerbpostcardmisapinalutoloansprincebairdasimcareinalapitanduonearlyadvanceddaaniconbeinteprosperdelpookbiggestnamingformasmulbumababaso-calledjerryofficecallercontentipapahingawebsitenegativeinvolveleftetoinformationumilingidea4thcigarettedaddypinunitelleniosataprivateexamplekapilingwaitattackmakapilingsalapivisualcontrolailingcontrollededittechnologyreturnedmenutechnologicalcallingnaghuhumindigunahininaabutannapapasayamakakayavirksomheder,palipat-lipattravelerpagkahaponagpakitanamulatpaghahabinagsuotnagdiretsotinayuniversityprodujostoryisinagotkaninanangyarilikaspantalonna-curiousorkidyastumitigilpinabulaanhinampasnangingisaytakotnakakapuntadespuesnaalisangkopnapilitangcarolwinsaaisshbilanggomagkaibangsumusunobalanghinigitcnicocharismaticfiapanayisaacfionatradehigitcontestbobospentstaplekararatingnutrientesdelejackyharingfaceincreasedconsiderarcualquierataquesngingisi-ngisingespecializadasnakaliliyonginirapannapakamotrizalnapatawagpagsalakayseguridadkinasisindakangaspagdudugokamautak-biya