Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "medicine"

1. Advances in medicine have also had a significant impact on society

2. Ang albularyo sa kanilang baryo ay kilala sa kanyang kaalaman sa herbal medicine.

3. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

4. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

5. Laughter is the best medicine.

6. Microscopes are commonly used in scientific research, medicine, and education.

7. Microscopes have played a critical role in the development of modern medicine and scientific research.

8. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

9. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

Random Sentences

1. Ang pagmamahal at pag-aalaga ng aking kabiyak ay nagbibigay sa akin ng kasiyahan at kaligayahan.

2. Makisuyo po!

3. Terima kasih banyak! - Thank you very much!

4. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

5. They travel to different countries for vacation.

6. Wer nicht wagt, der nicht gewinnt.

7. Nagsisigaw siya nang makitang wala pang hapunan.

8. Ang kulambo at unan ay karaniwang ginagamit upang mapanatili ang kaginhawaan habang natutulog.

9. La música puede ser utilizada para transmitir emociones y mensajes.

10. Mag o-online ako mamayang gabi.

11. Sorry hindi kita nasundo. apologetic na sabi si Maico.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. I've been taking care of my health, and so far so good.

14. He was born on December 30, 1984, in Akron, Ohio.

15. Siembra las semillas en un lugar protegido durante los primeros días, ya que el maíz es sensible al frío

16. Isang araw sa kainitan ng tanghali, isang mahiwagang babae ang dumating at kumatok sa mga pintuan ng mga taong bayan.

17. Nais ko sanang magkita tayong muli dito sa halamanang ito mamayang gabi.

18. 5 years? naramdaman ko yung pag iling niya, 1 year..?

19. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

20. Fathers can be strong role models, providing guidance and support to their children.

21. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

22. Ano ho ba ang itsura ng gusali?

23. This is a tough situation, but we'll get through it if we hang in there.

24. Nakalimutan ko na biglaang may appointment ako kanina kaya hindi ako nakapunta.

25. Magsisine kami sa makalawa ng hapon.

26. Ang pangalan niya ay Ipong.

27. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

28. Ang pagtitiwala, ayon sa karanasan.

29. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

30. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

31. Nakita nilang ang balat ng bunga ay manipis at maliit ang buto.

32. Bumili ka ng blusa sa Liberty Mall.

33. La desigualdad económica y social contribuye a la pobreza de las personas.

34. The disagreement between them turned out to be a storm in a teacup.

35. Mi vecino tiene una labradora dorada que siempre corre a saludarme.

36. En invierno, los lagos y ríos pueden congelarse, permitiendo actividades como el patinaje sobre hielo.

37. Ang mga salaysay tungkol sa buhay at mga gawain ni Rizal ay naging paksa ng mga akademikong pag-aaral at pagsasaliksik.

38. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

39. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

40. Using the special pronoun Kita

41. May notebook ba sa ibabaw ng baul?

42. Ang sugal ay isang bisyong maaaring magdulot ng malaking pinsala sa buhay ng isang tao.

43. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

44. It was risky to climb the mountain during a thunderstorm.

45. The early bird catches the worm.

46. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

47. Las vendas estériles se utilizan para cubrir y proteger las heridas.

48. Magsuot ka palagi ng facemask pag lalabas.

49. Det er også værd at bemærke, at teknologi har haft en stor indvirkning på vores samfund og kultur

50. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

Recent Searches

medicinesuccesskinatatakutankasamaangnewstaong-bayanalas-doseantonionakakalasingeksportenhawlafrescolendingbaulpagbahingnalasingnagingferrerkubyertoskalakihannalalabimakakawawapamahalaanpagtatanongmakikinignakahainnabigyansteamshipsnabasadoingpapansininmakatayoallefe-facebookgoalisamatelefonpakilutofauxdahanlumuhod1876lamesacommissionyeselectiontwinkleumarawincreasestabakanghealthierpinagpatuloyreserbasyonkinabubuhayikukumparanakasakitkumaripasfavorkaliwanaglaroayonmahahawacruzmagtipidanilamaghintaytokyobagkuskasaysayaninulithospitalhusobarnesbroadcastsnakapikitputiginisingsumapitfeelalas-diyesrevolucionadogustingculturalnakatirahoneymoonabut-abotmasarapganitopinangalanangnapatigilmoviepinangalananpwedenghaponparaangsabongtalinowashingtonmamarilkulisapmataaasadoptedbilaobritishrichritwalpaghingikasaganaanplatohanngisinatatanawdivisionthemtiyamentalpartypagkakatuwaancomplexpinunithinimas-himasbefolkningen,manggagalinglumalakipagsubokpagtawanamuhaymamalasbusiness:worknaawakirbysandwichverden,pangalananbutterflymaghatinggabipalapagsmilenararapatparokrusyeppumuntaresearchinalalayanheftygenerationerpacenagulatnaka-smirksawasukatnagpipiknikmakakiboinvitationpananglawmagsunognakainommatagumpaypayapangperseverance,makasarilingtuvoproductividadallowingsuccessfulsumindilagaslaslasingerodividesboyetnakaraanamingservicespapasatumayomagpapabunotnakakapasokmagtanghalianimpornakauwipinagbigyanpatakbonakatindigalagangnakainmatutonghomesbestwatchingmaestrouboasindisappointmaramiuponpongincrease