Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "books"

1. A couple of books on the shelf caught my eye.

2. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

3. Amazon's Kindle e-reader is a popular device for reading e-books.

4. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

5. He bought a series of books by his favorite author, eagerly reading each one.

6. He likes to read books before bed.

7. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

8. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

9. She has written five books.

10. She reads books in her free time.

11. The library has a variety of books to choose from, ranging from classics to modern literature.

12. There are a lot of books on the shelf that I want to read.

13. They go to the library to borrow books.

14. This can include reading other books on the same topic, interviewing experts, or gathering data

15. This could be physical products that you source and ship yourself, or digital products like e-books or courses

16. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Sa wakas, aalis na si Ogor, naisip niya.

2. La pobreza es un problema que afecta a millones de personas en todo el mundo.

3. Gusto ko pumunta ng enchanted kingdom!

4. No puedo comer comida picante, me irrita el estómago.

5. Human trafficking is a grave crime that needs immediate action worldwide.

6. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

7. Sa anong tela gawa ang T-shirt?

8. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

9. Este año planeamos viajar a España durante las vacaciones de verano.

10. Hallo! - Hello!

11. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

12. Our relationship is going strong, and so far so good.

13. Madalas na naglulusak sa dumi ang mga bakuran.

14. Matapos ng ilang araw ito ay namulaklak.

15. Bawat galaw mo tinitignan nila.

16. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

17. Scissors are commonly used for cutting paper, fabric, and other materials.

18. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

19. Tumatawa pa siya saka pumikit ulit.

20. Break a leg

21. Gusto ko ang malamig na panahon.

22. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

23. Madalas sya nagbibigay ng pagkain sa pulubi.

24. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

25. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

26. Bumibili si Erlinda ng palda.

27. Nilalakad namin ang mapa para mahanap ang aming pupuntahan.

28. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

29. I used my credit card to purchase the new laptop.

30. The acquired assets will be a valuable addition to the company's portfolio.

31. The momentum of the protest grew as more people joined the march.

32. Maarte siya sa kanyang pagpili ng libro kaya halos lahat ng kanyang binabasa ay mga klasikong nobela.

33. Sige maghahanda na ako ng pagkain.

34. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

35. Hindi niya naiilagan ang dagok ni Ogor.

36. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

37. Ordnung ist das halbe Leben.

38. Lumiwanag ang paligid dahil sa paputok.

39. Nagtatanong-tanong ako sa kanyang mga kaibigan upang malaman kung ano ang mga gusto at ayaw ng aking nililigawan.

40. Nag-asaran, naglokohan at nagtawanan sila.

41. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

42. Natigilan siya. Tila nag-iisip kung anong gagawin.

43. Nagbigay ng biglaang meeting ang boss ko kanina kaya hindi ako nakapaghanda.

44. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

45. Till the sun is in the sky.

46. Ailments are physical or mental health conditions that cause discomfort or illness.

47. Børn skal have mulighed for at udtrykke sig og udvikle deres kreative evner.

48. Nahanap niya ang nawawalang susi sa ilalim ng tarangkahan ng kotse.

49. Pumunta si Clara sa bahay ni Maria.

50. Les enseignants doivent évaluer les performances des élèves et leur donner des feedbacks constructifs.

Similar Words

e-books

Recent Searches

bookshinimas-himasnenabibilibundokcuentannagtataaspanghabambuhayawtoritadongnananalolalowatawatfreelanceramericanhumakbangmarinigcultivarmamalashinanakitshoppingpressmalezakananalinpacienciakanayangarbejdsstyrkekonsultasyonkategori,niyobalatnegrosseekpioneerpagkagisingwaitermamimalawakfederaltelebisyonbumagsakguardafatherpagkamanghakulayjudicialkabarkadabrideshowsumupomakasilongmentalbayangvetootrasnagpagawawalonggearmasasabibukodhampasmayamangiwinasiwaskumaenkontinentengrateisinusuotislandkinalilibingandevicesfranciscoandresenglishnanunuribalinganpagkakatuwaanhihigitdinidaramdaminayokopulitikoformamagbabalapulaabalanapatulalasamfundtiniklingsiniyasatlaryngitisangkopinakyatadecuadosinonggymgigisingbiglaanmagpuntapatunayanmananaloherramientaroughisasamamagamotsundaeabeneadvanceresortpagtatanimsumalasiguradothereforediaperplagaswatchingmakakacharmingcandidateglobalpagsagotitinulosplatformsnabuhayeithermanilanangangalogdreamstumamaalmacenarmaubosdaladalahahatoltatlosteersigemahihirapclassescontinuedcassandrawritepagbahingscheduletechnologylumipadautomaticscalelumusobnapilingjoshuabinilingmakatuloghatelaternatutulogsiglakampanagirlfriendrelographicaraw-pagkaeventsnagpaalamcontrolarlasspentmaligayapangarapnaglinispagsusulitkongpaidmerryinstrumentalpabigatnapapalibutanpagonglaamangmarienag-aabanghalamangnangapatdanrevolucionadositawbalediktoryantonightpaabigotevelfungerenderesearch:lenguajegrocerykauntibeenteknologimakuhangkatedralmagkasamamaitimginisingkagalakan