Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "example"

1. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

2. Kanina sabi mo joke, ngayon example. Ano ba talaga?!

3. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

4. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

Random Sentences

1. Sa kanyang pagbabasa ng libro, biglang napadungaw ang kanyang mata sa isang nakakatuwang larawan.

2. Emphasis can be used to create a memorable and impactful message.

3. Mon mari a fait une surprise pendant notre cérémonie de mariage.

4. The impact of the pandemic on mental health has been immeasurable.

5. Puwede ba akong sumakay ng dyipni?

6. International cooperation is necessary for addressing global environmental challenges, such as climate change.

7. Magkano ho ang arkila ng bisikleta?

8. Ang pagiging malilimutin ni Ana ay laging nagdadala ng problema sa kanilang grupo.

9. Love na love kita palagi.

10. Det er en metodisk tilgang til at forstå verden omkring os og finde årsager til de fænomener, vi observerer

11. He applied for a credit card to build his credit history.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

14. Hindi ko alam kung paano maaalis ang aking mga agam-agam sa aking kinabukasan.

15. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

16. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

17. Mas maganda ang ambiance sa dapit-hapon kaysa sa ibang oras ng araw.

18. The professor delivered a series of lectures on the subject of neuroscience.

19. Sa bawat tagumpay, dapat nating ipagdiwang ang bawat pagsisikap na ginawa natin, datapapwat ay hindi naman ito palaging madaling maabot.

20. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

21. Nakapag-celebrate kami ng aming anniversary ng asawa ko kaya masayang-masaya ako ngayon.

22. Mathematical formulas and equations are used to express relationships and patterns.

23. I can tell you're beating around the bush because you're not looking me in the eye.

24. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

25. Technology has also played a vital role in the field of education

26. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

27. Mahusay gumawa ng bahay ang kanyang tatay.

28. Paano ka nakapasok sa bahay kagabi?

29. May email address ka ba?

30. Emphasis can also be used to create a sense of urgency or importance.

31.

32. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

33. Ang mommy ko ay masipag.

34. Nakarating na kami sa aming pupuntahan.

35. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

36. Napakaganda ng loob ng kweba.

37. Les enseignants doivent respecter les normes de sécurité en vigueur dans les écoles pour protéger les élèves.

38. Hinila na ni Kirby si Athena papunta sa table namin.

39. Les enfants commencent l'école maternelle à l'âge de 3 ans.

40. The app has also become a platform for discovering new music, with songs going viral through TikTok.

41. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

42. Ang kagutuman ay laganap sa mga lugar na may kalamidad.

43. Nagwelga sina Ka Leo laban sa pamahalaan.

44. Sa matinding takot ay nagsunuran ang mga mangingisda sa di nila nakikilalang matanda.

45. Have they finished the renovation of the house?

46. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

47. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

48. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

49. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

50. "A barking dog never bites."

Recent Searches

programskapilingexampletypesberkeleywhilebitbitmethodslagifacultyonline,ngitimarketinglahatasklegendnakatuwaangloob-loobmalapalasyopinapasayareachingorkidyasdahilmanlalakbaytechnologicalavanceredeituturobinge-watchingalmacenarinitmakawalasabadonglever,admiredpag-isipannag-aalangantumangoeducationkumarimotjoymovinglibrobetahumahangaanibersaryokwelyoagaw-buhayskillbakateachingsparisukatpongbumagsakmerlindanawawalapataykinainshockphilippinecarolninyolazadamatayogdiseasemaisipmatesafiverrpatongnatitirapinagsikapanmakapangyarihangnagsisipag-uwianmagpa-ospitalgumagalaw-galawoktubreculturadistansyaikinalulungkotnagpaalampagkahapomagkakagustonaguguluhangnagbakasyonmagkaibiganmagkasintahannagtagisannakakatawanagtitindapapuntaisulatmagkaibangflyvemaskinermahahanayinasikasopinagkiskislabing-siyamaanhinnakasandigmiranakapaligidnagkasakitlandlinepagkaraanami-misspagsisisipinagawamahinogtatagalmontrealpaglapastanganbusinessesbakantemasaganangnabigyanpalamutimagkanobyggetpinangalanangmiyerkulesmagagamitistasyonna-fundmaghapongdumilathawlanangingisaypagsusulitkilaykalaropinipilittsismosahinalungkatininomfarglorialaganaparabiamaglabaipinangangakretirarhimutokgrocerylugawdyosatagalarturolookedtinitirhaninangalaynaka1950sibinalitangheartbreakkabuhayandefinitivomataraynagbasadreamdulotlandobalancessnaflavionagdangerousasodinanasbumubulagalitlalongcombatirlas,balitabellmalapitsatisfactionadvanceddamitproducirmuchosmajorlabing1973tools,natingala1980misalegendslamesaginangbecomepartypanayomelettemestwaysimagingabslibrepda