Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "nagyayang"

1. Pagkababa, mabilis na siyang nagyayang umuwi.

Random Sentences

1. Muntikan na akong mauntog sa pinto.

2. Kumain na ako pero gutom pa rin ako.

3. Oscilloscopes are useful for troubleshooting electronic circuits, identifying faults, and verifying signal integrity.

4. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

5. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

6. Napuno ako ng lungkot at naglabas ng malalim na himutok sa harap ng aking mga kaibigan.

7. She has adopted a healthy lifestyle.

8. The number you have dialled is either unattended or...

9. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

10. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

11. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

12. Ang mabuting anak, nagpapalakas ng magulang.

13. Unti-unti siyang palayo sa pangkat dahil nais niyang mapag-isa.

14. Nagpapakain ako ng aking aso sa hatinggabi bago kami pareho matulog.

15. Human trafficking is a grave crime that needs immediate action worldwide.

16. Buti naman. Ayoko mahawaan ng kuto eh.

17. Tinikman nila ang hinog na bunga at natuwa sa tamis at sarap nito.

18. ¡Muchas gracias por el regalo!

19. Bumili kami ng isang piling ng saging.

20. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

21. Ang bawat tao ay may natatanging abilidad na nagbibigay kahulugan sa kanilang buhay.

22. He admires the athleticism of professional athletes.

23. Promise babayaran kita in the future. sabi ko sa kanya.

24. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

25. Kumusta ang nilagang baka mo?

26. "Masaya ako na nakilala kita," ani ng bagong kaibigan ko.

27. Sa naglalatang na poot.

28. Si Jose Rizal ay pinagpalaluan ng mga Pilipino bilang bayani ng bansa.

29. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

30. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

31. Maputla ang kulay ng kanyang mukha ay aywan ba niya at pati siya ay tila pinanawan ng lakas.

32. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

33. Stress can be a contributing factor to high blood pressure and should be managed effectively.

34. The children eagerly lined up for their share of the birthday cake.

35. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

36. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

37. After finishing the marathon, the runner was euphoric with their achievement.

38. Athena ang aga aga nakasimangot ka na kaagad.

39. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

40. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

41. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

42. Estudyante sina Rita at Fe sa UP.

43. Les enseignants sont formés pour répondre aux besoins individuels des étudiants.

44. Ang kanyang ngiti ay maaliwalas at nakakahawa.

45. Nasa harap ako ng istasyon ng tren.

46. Beber suficiente agua es esencial para una alimentación saludable.

47. The scientist conducted a series of experiments to test her hypothesis.

48. Miguel Ángel es considerado uno de los artistas más influyentes de la historia del arte occidental.

49. Eine gute Gewissensentscheidung kann uns helfen, unser Leben in eine positive Richtung zu lenken.

50. Las redes sociales son una parte fundamental de la cultura digital actual.

Recent Searches

babenagyayangsubjectnakainsuwailsellingtopicsementonanunuribopolstog,piernagsamabetweenpinakidalainomcapitalistnagandahanmaulitmagbalikpitotoynandiyanbilinahulipinag-usapannakumbinsilibertariansolidifynagdalagitaralinggoprogramsformsmagkasing-edadcallnagpipiknikmakahirampacebilingnamumulotharapnapapadaanmakaratingreplacedencountersinagotdeterioratemestactivitydisappointmulmakakakaennilinistaingalightnabubuhaynothinguminomsamaupodyosamalasutlavirksomheder,communicatemagbigayannakapaligidpinagsikapankumananibinalitangeneropandalawahankasamahanmahirappasyentekilaypawisbairdibinubulonglalakengbigyannandyanharinginvestingmahiyaagilafametibokipinikitaniyamakahihigitipaghandanapahintonegosyantenagpakilalanagtinginanprofessionalpakakatandaanyelolabinsiyamlegendkasamaankinahayoppinabulaanputolclassesnambrasosearchiskedyulpagemaaliwalasbumagsakasignaturadinalafatalkababaihanbiluganginuulcermobilerawnasasabihanpaghaharutanjunionag-poutlearningtasaunidosexcusehinogwithoutpagsagotsharmainenanglupamartesnagngangalanginaabutankamustamagpalagokaklasekanyafloortupelosumasambaumanodurantemanananggalpaldapangalananinalalayanimaginationrestaurantnahihiloumigtadataquessumakayngisinaabotnalugodsurveyspagbatihinagisanitolightssakinkasodollarsuelomalumbayroonkataganakalilipastravelermagkikitaganangtotoofilipinapanalanginkarwahengricakatapataffiliatetrabahofestivalesescuelastag-ulankontranangagsipagkantahanmagbibigaytinggreatlyafternoonpupuntahandropshipping,partnerrenacentistatinaybevare