Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "democracy"

1. Andrew Jackson, the seventh president of the United States, served from 1829 to 1837 and was known for his expansion of democracy and his controversial policies towards Native Americans.

2. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

3. The United States has a system of government based on the principles of democracy and constitutionalism.

4. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

5. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

Random Sentences

1. Itim ang gusto niyang kulay.

2. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

3. The clothing store has a variety of styles available, from casual to formal.

4. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

5. Nandoon lamang pala si Maria sa library.

6. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

7. Nais ko sanang magkita tayong muli dito sa halamanang ito mamayang gabi.

8. Si Carlos Yulo ang naging inspirasyon sa pagbuhay muli ng gymnastics program sa Pilipinas.

9. Dedication is the driving force behind artists who spend countless hours honing their craft.

10. Television is a medium that has become a staple in most households around the world

11. Ngunit tulad din ng mga ibon, tinanong nila kung bakit siya nasa kanilang kampo samantalang isa siya sa mga kaaway.

12. She is not drawing a picture at this moment.

13. Kangina pa ako nakapila rito, a.

14. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

15. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

16. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

17. Der kan være aldersbegrænsninger for at deltage i gamblingaktiviteter.

18. Sa dapit-hapon, masarap mag-picnic kasama ang pamilya at kaibigan.

19. Ang hudyat ay isang senyales o tanda na nagbibigay impormasyon o nagpapahayag ng isang ideya o kaisipan.

20. Kain na tayo. yaya ni Maico sa amin.

21. Gumagalaw-galaw ang sabog na labi ni Ogor.

22. Les hôpitaux peuvent être surchargés en période de crise sanitaire.

23. The Taj Mahal in India is a magnificent wonder of architecture.

24. Nagtatrabaho ako sa Student Center.

25. Emphasis can help to ensure that a message is received and understood by the intended audience.

26. El Día de San Valentín es una oportunidad para demostrar el amor que sentimos por nuestras parejas.

27. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

28. Napakaganda ng mga pasyalan sa bansang Singapore.

29. May mga espesyal na pagdiriwang tuwing Linggo sa aming komunidad malapit sa karagatan.

30. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

31. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

32. Hindi ko maipaliwanag ang aking agam-agam sa magiging resulta ng aking pagsusulit.

33. She has won a prestigious award.

34. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

35. Fødslen kan tage lang tid, og det er vigtigt at have tålmodighed og støtte.

36. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

37. Risk tolerance is an important factor to consider when deciding how to invest.

38. Microscopes have played a critical role in the development of modern medicine and scientific research.

39. Las hojas del libro están todas marcadas con notas adhesivas.

40. Pakain na ako nang dumating ang kaibigan ko.

41. Hindi ko alam kung paano mo ito tatanggap, pero may gusto ako sa iyo.

42. Tila may nais siyang ipahiwatig sa kanyang mga kilos.

43. Seeing a favorite band perform live can create a sense of euphoria and excitement.

44. Oo malungkot din ako. Mamimiss kita.

45. Ang paggamit ng droga ay maaaring magdulot ng pagkakaroon ng mga karamdaman, tulad ng mga sakit sa puso, kanser, at mga problema sa paghinga.

46. Sino ang puwede sa Lunes ng gabi?

47. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

48. Taman Mini Indonesia Indah di Jakarta adalah tempat wisata yang menampilkan miniatur kebudayaan Indonesia dari 33 provinsi.

49. Sa gitna ng gubat, nagbabaga ang apoy na ginagamit nila upang magluto.

50. Laging may buslo ng bulak sa tabi ang lola, at isang mahabang patpat na kidkiran (huso, spindle) ng sinulid.

Recent Searches

democracyyamanmansanassurgerylonglcdperanggamesdemocraticnathanrailkakahuyandoinginteracteitherbetweenclientepasinghalechaveimprovedclearcrazynakikitapahirammakukulayabanglawsuuwifallaboknagsipagtagosumusunodpistakaratulangpinaghatidannakakatabamataassakupincampaignskasifanskayapakilagaypagkakamalinagpepekemanamis-namiskumitakasalanantinulak-tulakjuegosinabutanlondonnapakahabagirlnawalangmaibigaykulturlihimpapuntangnagbentafitnesscountrytatanggapininuulampinapakingganmagsabina-curiousvedvarendeumagangamuyinherramientasdealkuligligiwananpanginoonsumasayawpagsisisimasinopbuwayaaniyapumansinpondowednesdayshoppingdreamstigaspinatirahahahapagsambaejecutanhikingparinpitumpongdisposalviolencestohmmmlaybrarivelstandkonglendingpakinabanganisaaccongressiskokwebafionatendermarchopdeltsurroundingsmatagumpaykanilanunsorrysusunduintrafficloricigarettespakpaklarrydaybrideateespadayanbranchesalitaptapkailaninvolvedoonprotestaannareturnedableandroidnakitakampeonkungtindigpawiinsino-sinolalakadmababawnaantigkahilinganipihitmensajespagkasubasobnamulaklakmag-asawangpinalalayasnegosyoulitinventionkinuhamakisigmarahanbaduylanadumeretsobolapalusotmalungkotdetmaliksimasarapasukalkagayapaskongcoallotniligawanpaghingibakanalalaglagmadridabalaamokatandaanilangamerikanakumbinsimagpa-ospitalnagtatanongressourcernenanalokumembut-kembotmagpa-picturestornapatayokarununganisasabadinvesting:daramdaminparehongmensahenagkasakitdahannakasunod