Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "dogs"

1. "Dogs are better than human beings because they know but do not tell."

2. "Dogs are like potato chips, you can't have just one."

3. "Dogs are not our whole life, but they make our lives whole."

4. "Dogs come into our lives to teach us about love and loyalty."

5. "Dogs leave paw prints on your heart."

6. "Dogs never lie about love."

7. "Let sleeping dogs lie."

8. "The better I get to know men, the more I find myself loving dogs."

9. A couple of dogs were barking in the distance.

10. Dogs are often referred to as "man's best friend".

11. Dogs are social animals and require attention and interaction from their owners.

12. Dogs can be trained for a variety of tasks, such as therapy and service animals.

13. Dogs can develop strong bonds with their owners and become an important part of the family.

14. Dogs can provide a sense of security and protection to their owners.

15. Dogs can provide emotional support and comfort to people with mental health conditions.

16. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

17. I can't believe how hard it's raining outside - it's really raining cats and dogs!

18. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

19. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

20. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

21. It's raining cats and dogs

22. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

23. Many dogs enjoy going on walks and exploring new environments.

24. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

25. Pets, including dogs, can help children develop empathy and responsibility.

26. The roads are flooded because it's been raining cats and dogs for hours now.

27. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

28. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

29. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

Random Sentences

1. Den danske kirke fejrer påsken med flere forskellige ceremonier i løbet af Holy Week.

2. Mahirap bilangin ang mga bituin sa langit.

3. Rektanggulo ang hugis ng mesa namin.

4. This has led to increased trade and commerce, as well as greater mobility for individuals

5. The acquired assets were key to the company's diversification strategy.

6. Vielen Dank! - Thank you very much!

7. Ano ang pangalan ng doktor mo?

8. Kapag walang magtutulungan, walang magtatagumpay.

9. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. "Dogs are better than human beings because they know but do not tell."

12. Sa mga mahahalagang desisyon, nagkakasundo kami bilang magkabilang kabiyak.

13. La agricultura es una actividad fundamental en muchas regiones del mundo.

14. Nag-reply na ako sa email mo sakin.

15. Ano ang nasa bag ni Cynthia?

16. "Ang oras ay ginto" ay isang bukambibig na nagpapahiwatig ng halaga ng paggamit ng oras nang maayos at wasto.

17. Nakita ko ang kanyang halinghing na unti-unti nang bumibilis dahil sa takot.

18. A quien madruga, Dios le ayuda.

19. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

20. Beth ang pangalan ng matalik kong kaibigan.

21. Ayaw mo ba? tanong niya sa malungkot na tono.

22. Tila asong nagpipilit makapaibabaw si Ogor.

23. El ajedrez es un pasatiempo que disfruto desde niño.

24. Algunos artistas famosos incluyen a Leonardo da Vinci, Pablo Picasso y Frida Kahlo.

25. Sa katagalan, natanggap na niya ang panunuksong ito.

26. Certains pays et juridictions ont des lois qui régulent le jeu pour protéger les joueurs et prévenir la criminalité.

27. Ang Ibong Adarna ay nagpakita ng magagandang aral tungkol sa katapangan, pagkakaisa, at pagpapatawad.

28. Namnamin mo ang halik ng malamig na hangin sa umaga.

29. Ang mga nangunguna sa industriya ay kadalasang itinuturing bilang mga eksperto at mga awtoridad sa kanilang larangan.

30. Sa mga taludtod ng kundiman, nararamdaman ang saya at lungkot na dulot ng pag-ibig.

31. Setiap agama memiliki tempat ibadahnya sendiri di Indonesia, seperti masjid, gereja, kuil, dan pura.

32. Nakakalungkot isipin na wala na si Fr. Manoling Francisco, SJ, isa sa mga nagtatag ng Bukas Palad.

33. Dedication is the driving force behind artists who spend countless hours honing their craft.

34. Oscilloscopes can capture and store waveforms for further analysis and comparison.

35. John Adams, the second president of the United States, served from 1797 to 1801.

36. Nahihirapan ka na siguro.. sorry.

37. Nagwo-work siya sa Quezon City.

38. Menjaga hubungan yang harmonis dan menyenangkan dengan orang-orang di sekitar kita dapat meningkatkan kebahagiaan dan kepuasan hidup.

39. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

40. Emphasis is the act of placing greater importance or focus on something.

41. Kapag ako'y nag-iisip nang maayos at walang stress, ako'y nakakamit ng isang matiwasay na pag-iisip.

42. At ignorere sin samvittighed kan føre til skyldfølelse og fortrydelse.

43. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

44. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

45. Ang sugal ay isang aktibidad na nasa ilalim ng panganib ng pagkakaroon ng adiksyon at mental na kalusugan.

46. Have you been to the new restaurant in town?

47. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

48. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

49. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

50. Laking pagkamangha ni Aling Rosa ng makita ang anyo ng bunga nito.

Recent Searches

inantaydogsmagtatagalnagpakitagagaginoonahuliyumabongsoportetillnakatingingconsanpagkakatayokaarawanpropesorusenamanagpasyaabalangbinibinisapatosenterisatahanannamanmaunawaanpagkahapoairportfindtingingmalakisinundotwodraft:addressmakainsamfundgospeleranbakademocracytutungoencounterwalongmagbagong-anyokumukuhatilgangvelstandmaonginisipnilolokokumbentobitiwanblognakagalawupuansementeryoipinikitbintanaadditionallyhindemabatongrosariohumingikungdiyosbinibiyayaansuotmagbakasyonhalamangpagkaraanayonkakilalalumangoysumuwayikinakatwiranhojaseksperimenteringsampungpatalikodshiftcountriesgumantikonsentrasyonkaybiliskonsyertonakataasiskohierbasmedicinehinahanapvenusbasascientificestate10thnangangaralmaninirahanbinatangabernunoaabsentclubhongtrentapaakyatmayroongkondisyonnasasabihanpinaghatidanalignsrabespendingwonderknowprospermayniladistancehinanapadvertising,pulisresearchlumisannaantigreservedkahitnahuhumalinglegacybiyasvisualngusotransithanapbuhaypacenanalopicturevitalfacultyagadperawasakganangtelevisionhalamantuluyanbahaynag-emailsignificantparabigonghiligroboticshalamananmamataanmahagwayperanggameskumiloscreatehasmarurumikomunikasyonbaranggaynakangisimaskibinilingminamadalimagandangbayaantangingkingoutmagkasamapasyabrainlymuchpresidentialaddictionscientistpackagingdiedrenacentistaeksamginilinghaponngisidiscoveredplacenakiramaypigingschedulebumibilihalakhakpatilucassmallevnepag-amingrins