Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "dogs"

1. "Dogs are better than human beings because they know but do not tell."

2. "Dogs are like potato chips, you can't have just one."

3. "Dogs are not our whole life, but they make our lives whole."

4. "Dogs come into our lives to teach us about love and loyalty."

5. "Dogs leave paw prints on your heart."

6. "Dogs never lie about love."

7. "Let sleeping dogs lie."

8. "The better I get to know men, the more I find myself loving dogs."

9. A couple of dogs were barking in the distance.

10. Dogs are often referred to as "man's best friend".

11. Dogs are social animals and require attention and interaction from their owners.

12. Dogs can be trained for a variety of tasks, such as therapy and service animals.

13. Dogs can develop strong bonds with their owners and become an important part of the family.

14. Dogs can provide a sense of security and protection to their owners.

15. Dogs can provide emotional support and comfort to people with mental health conditions.

16. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

17. I can't believe how hard it's raining outside - it's really raining cats and dogs!

18. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

19. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

20. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

21. It's raining cats and dogs

22. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

23. Many dogs enjoy going on walks and exploring new environments.

24. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

25. Pets, including dogs, can help children develop empathy and responsibility.

26. The roads are flooded because it's been raining cats and dogs for hours now.

27. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

28. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

29. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

Random Sentences

1. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

2. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

3. Umaasa si Carlos Yulo na mas maraming kabataan ang mahihikayat na pasukin ang larangan ng gymnastics.

4. Marunong nang maglinis at magtago ang mga taong marurumi.

5. Bumili si Ana ng lapis sa tindahan.

6. Hindi siya naging maramot nang magbigay ng kanyang oras para tumulong sa proyekto.

7. Susunduin ako ng van ng 6:00am.

8. Le travail est une partie importante de la vie adulte.

9. Shaquille O'Neal was a dominant center known for his size and strength.

10. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

11. La contaminación del agua es un problema grave que afecta la calidad y disponibilidad del agua.

12. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

13. She admires the beauty of nature and spends time exploring the outdoors.

14. I love the combination of rich chocolate cake and creamy frosting.

15. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

16. Kanino ka nagpatimpla ng cocktail drink?

17. Nabasa mo ba ang email ko sayo?

18. Napakaganda ng mga pasyalan sa bansang Singapore.

19. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

20. La arquitectura es una forma de arte que se centra en el diseño y construcción de edificios.

21. Masaya ang buhay kapag mayroong kaulayaw na handang tumulong sa iyo.

22. To break the ice at a party, I like to start a game or activity that everyone can participate in.

23. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

24. Nasa kumbento si Father Oscar.

25. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

26. Kumakain sa cafeteria ng sandwich.

27. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

28. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

29. Mayroon pa ho sana akong gustong itanong.

30. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Naging kasangkapan ng mga Espanyol ang Katolisismo upang lalong mapadali nila ang pamamalakad dito.

33. Hindi ko alam kung bakit hindi ka pa rin nakakapag-move on sa kahit anong nangyari.

34. We need to optimize our website for mobile devices to improve user experience.

35. Ang sakit ng kalingkingan ay ramdam ng buong katawan.

36. The charitable donation made it possible to build a new library in the village.

37. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

38. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

39. Sino ang kasama niyang nagbakasyon?

40. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

41. Madalas kami kumain sa labas.

42. Hindi ko na kayang panindigan ang aking pagkatao dahil sa inis na nararamdaman ko.

43. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

44. Mahalagang magtiwala sa ating kakayahan upang maabot natin ang ating mga pangarap, samakatuwid.

45. Napatakbo ako sa kinalalagyan ng landline ng tumunog yun.

46. Ang marahas na pag-atake ay labag sa batas at maaaring magdulot ng malubhang parusa.

47. Minsan ay isang diwata ang nagpanggap na isang babaeng madungis.

48. She wakes up early every morning to exercise because she believes the early bird gets the worm.

49. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

50. Tahimik ang kanilang nayon.

Recent Searches

dogspatakbongpresleyadvertisingkamakailanmoneypapelkuneavailablespareteamprocesshigpitanvictoriadiretsahangheartbutmusiciansnapalitangmabigyanumiwaslifevideoafternoonelectionsejecutanusednakalilipashayaanhousegrahamcultivatedhealthierjeepneycover,televisiontenpagkokakbayanipinaulananpamumunobasapinapakaintag-arawmasarapmoviepahiramnalugmokmeaninggenenanalomedya-agwamaalwangdaangafterpagpapasanpapaanotraditionalageskayabanganmakapangyarihangreachjobumiinomofrecennagwalistransportationmagka-babyrimastinioeyedioxidepatientlumingontiyanpinasalamatanmateryalesroommarahascarenapatakboupodeathnalalabikalakiservicestinaposahasboypuntahanrenacentistaroleginacapitalsaritacombatirlas,kamandagtelephoneinilistaanteskabinataankakuwentuhanpuladelvideosbateryatheystaylittlebagentertainmentjudicialwerenanigasabangsamantalangbossinterestssellingconstitutionpaligidjenalateyoungmarketing1973yourself,discipliner,lalomagandangagagagambapakisabifascinatingagilitylegislativepagkagustoiskoimportantessaidyeyaberagosto1977lossabaleadingconsumenamataynasanjingjingpalagaybanalnasarapanyorkkinikilalangkamalianfactoresbecomingtrafficverdennakakasulatyumanigbeyondawitinnakapangasawainanglumbayitspakpaknakabaonisinulatnaturalarbularyoborncharismaticimagesearlypaghaharutanexigentebook:cosechar,kalabanproductionhumahangosuulaminbasketgoodpesobiliskailanganemphasistrajesumusunokubonailigtasasalmalimitromeroname