Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "dogs"

1. "Dogs are better than human beings because they know but do not tell."

2. "Dogs are like potato chips, you can't have just one."

3. "Dogs are not our whole life, but they make our lives whole."

4. "Dogs come into our lives to teach us about love and loyalty."

5. "Dogs leave paw prints on your heart."

6. "Dogs never lie about love."

7. "Let sleeping dogs lie."

8. "The better I get to know men, the more I find myself loving dogs."

9. A couple of dogs were barking in the distance.

10. Dogs are often referred to as "man's best friend".

11. Dogs are social animals and require attention and interaction from their owners.

12. Dogs can be trained for a variety of tasks, such as therapy and service animals.

13. Dogs can develop strong bonds with their owners and become an important part of the family.

14. Dogs can provide a sense of security and protection to their owners.

15. Dogs can provide emotional support and comfort to people with mental health conditions.

16. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

17. I can't believe how hard it's raining outside - it's really raining cats and dogs!

18. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

19. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

20. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

21. It's raining cats and dogs

22. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

23. Many dogs enjoy going on walks and exploring new environments.

24. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

25. Pets, including dogs, can help children develop empathy and responsibility.

26. The roads are flooded because it's been raining cats and dogs for hours now.

27. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

28. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

29. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

Random Sentences

1. Ang magnanakaw ay napag-alamang anak ng isang kilalang kriminal sa lugar.

2. Si Emilio Aguinaldo ang pinakamatandang nabuhay na pangulo ng Pilipinas, na namatay sa edad na 94.

3. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

4. Menjaga hubungan yang harmonis dan menyenangkan dengan orang-orang di sekitar kita dapat meningkatkan kebahagiaan dan kepuasan hidup.

5. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

6. Más sabe el diablo por viejo que por diablo. - Age and experience trump youth and cleverness.

7. The football field is divided into two halves, with each team playing offense and defense alternately.

8. Sumang ayon naman sya sa mungkahi ng kanyang kasintahan.

9. Kapag nawawala ang susi, sinasalat niya ang bawat bulsa.

10. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

11. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

12. Nasa ilalim ng silya ang payong ko.

13. Makikiligo siya sa shower room ng gym.

14. Pedeng ako na lang magsubo sa sarili ko?

15. Hindi pa ako kumakain.

16. Matumal ang mga paninda ngayong lockdown.

17. My sister gave me a thoughtful birthday card.

18. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

19. Pasensya na, kailangan ko nang umalis.

20. Es importante tener en cuenta la privacidad y la seguridad al utilizar las redes sociales.

21. Ang pagdarasal o meditasyon ay nakagagamot sa aking kalooban at nagbibigay ng kapayapaan.

22. Ang mahal pala ng iPhone, sobra!

23. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

24.

25. Pinabulaanang muli ito ni Paniki.

26. Akala ko nung una.

27.

28. Mabuti na lamang at nandyan ang kanyang kaibigan.

29. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

30. She is not studying right now.

31. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

32. Halos hindi niya narinig ang halingling ni Ogor.

33. Magdoorbell ka na.

34. He has been repairing the car for hours.

35. La letra de una canción puede tener un gran impacto en la audiencia.

36. El agua es un símbolo de pureza, vida y renovación.

37. I am absolutely certain that I locked the door before leaving.

38. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

39. Ang kanyang ama ay isang magaling na albularyo.

40. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

41. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

42. Nagising si Rabona at takot na takot na niyakap ang kaniyang mga magulang.

43. Mababa ang sahod sa trabaho, kaya naghanap siya ng ibang mapagkakakitaan.

44. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

45. Hindi na napigilan ni Anna ang kanyang hinagpis nang marinig ang masamang balita.

46. Hindi maganda na maging sobrang matakot sa buhay dahil sa agam-agam.

47. Women have faced discrimination and barriers in many areas of life, including education and employment.

48. Les personnes âgées peuvent avoir des difficultés à se déplacer ou à effectuer des tâches quotidiennes.

49. Napupuno ako ng poot sa tuwing naaalala ko ang mga pagkakataon na ako'y pinagtaksilan at sinaktan.

50. She attended a series of seminars on leadership and management.

Recent Searches

mukasumagotdogssupilinopomaskimarteschoiblusanatandaanhmmmbagamatkalakihanbriefestablishjokedettecongresstelangkabibibusyangprimerterminoexcusesweetclaseshangaringreserveswordmarioespigasfuelguhitencompassestaingaseriouspopularizemahahabaitinago11pmmerrymaisgivearbejderwaribiglamapaibabawtransmitskapetillgrammarblusangadangsnasolarferrerbeeneducationalfatalcalldollarmetodeeksaytedmapadaliteamdumatingfistsspeedtuwidtwinklestatusstudentcomeshockkumarimotbelievedtransitbilisdontitinalicompartenmalinisrobotictennagreplylatestpinalutobilhinspecialcommissioncomienzanveryredesleukemiahinabanilinislegendsharingshiftcomputercomplexincludegitarahateneedsbehaviorwindowformsflashcompleteexplainberkeleytwopublishedcableipinalutoviewbasaelectedstopknowmenucommercegoingextraprovidedinteriorthoughtsonlytiyasquatteritlogdoscomputereflyactiondoonnothingcleancakeipapahingahimutokpagdespuesnagdaramdamhumihingimonghumarapadvertising,baoendviderenagsisilbikagalakanmallopdeltpagtiisanmagdamanueltungawmaaringlasingcigarettesakongsalitangmulti-billionbironakakapagpatibayrecordedreadpshpartnerkunwasuottoreteheartbeatkendiumagangmartiannilaostuktokfrancisconatabunanevolucionadoattentionkinamumuhiannamangpowerpointingaytarangkahantumigilnatatawatumitigilnagbibironagbabalainspirasyonallergynagsagawamag-iikasiyamalamnangampanya