Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

34 sentences found for "team"

1. A couple of goals scored by the team secured their victory.

2. Basketball is a team sport that originated in the United States in the late 1800s.

3. Football coaches develop game plans and strategies to help their team succeed.

4. Football is a popular team sport that is played all over the world.

5. Hockey coaches develop game plans and strategies to help their team succeed.

6. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

7. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

8. Natalo ang soccer team namin.

9. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

10. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

11. The athlete's hefty frame made them well-suited for their position on the team.

12. The basketball court is divided into two halves, with each team playing offense and defense alternately.

13. The football field is divided into two halves, with each team playing offense and defense alternately.

14. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

15. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

16. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

17. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

18. The mission was labeled as risky, but the team decided to proceed.

19. The objective of football is to score goals by kicking the ball into the opposing team's net.

20. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

21. The professional athlete signed a hefty contract with the team.

22. The project gained momentum after the team received funding.

23. The team captain is admired by his teammates for his motivational skills.

24. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

25. The team is working together smoothly, and so far so good.

26. The team lost their momentum after a player got injured.

27. The team won a series of games, securing their spot in the playoffs.

28. The team's colors are purple and gold, and they play their home games at the Staples Center.

29. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

30. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

31. The team's performance was absolutely outstanding.

32. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

33. The website's contact page has a form that users can fill out to get in touch with the team.

34. Winning the championship left the team feeling euphoric.

Random Sentences

1. Mangiyak-ngiyak siya.

2. Saya suka musik. - I like music.

3. Nationalism is a political ideology that emphasizes the importance of the nation-state.

4. Ako ngayo'y lumilipad at nasa langit na.

5. Si Ogor ang kanyang natingala.

6. Hatinggabi na nang iwasiwas na muli ng butihing Ada ang kaniyang makinang na pananglaw.

7. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

8. Pets, including dogs, can help children develop empathy and responsibility.

9. Naiilang pa ako sa kanya dahil bago pa lang ako sa pagliligaw, kaya hindi ko alam kung paano siya lapitan.

10. Magdamagan silang nagtrabaho sa call center.

11. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

12. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

13. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

14. Has he spoken with the client yet?

15. Kapitbahay ni Armael si Juang malilimutin.

16. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

17. Magkano ang tiket papuntang Calamba?

18. Magkapareho ang kulay ng mga damit.

19. The charitable organization provides free medical services to remote communities.

20. Ang nagdudumaling laro ng chess ay nangangailangan ng matinding kasanayan sa pagtatanghal ng mga hakbang at galaw.

21. Les scientifiques travaillent ensemble pour résoudre des problèmes complexes.

22. Kumaliwa ka papuntang Masaya Street.

23. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

24. Mabuti na lamang at nandyan ang kanyang kaibigan.

25. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

26. Maging si Amba ay natulala sa mahirap na disenyong nagawa ng matanda.

27. Kulay pula ang libro ni Juan.

28. Las plantas desempeñan un papel fundamental en el ciclo del agua, absorbiéndola del suelo y liberándola a través de la transpiración.

29. May lagnat, sipon at ubo si Maria.

30. Halos kassingulang niya si Ogor, ngunit higit na matipuno ang katawan nito.

31. Walang ano-ano ay lumipad at nakita ni Perla ito na pumunta sa halamanan at nagpalipat lipat sa mga bulaklak.

32. Magkano ang isang kilo ng mangga?

33. Congress, is responsible for making laws

34. Opo. Magkapareho po ba ang disenyo?

35. Erfaring har lært mig at tage ansvar og være proaktiv.

36. Umikot ka sa Quezon Memorial Circle.

37. They have renovated their kitchen.

38. Ahh nasa shower kasi si Maico sinagot ko na baka impor...

39. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

40. I always wake up early to study because I know the early bird gets the worm.

41. Puwedeng dalhin ng kaibigan ko ang radyo.

42. Di na ako magtataka dahil alam ko naman ang nangyari.

43. She prepares breakfast for the family.

44. Mila Romero ang pangalan ng tiya ko.

45. Hello. Ito po ba ang Philippine Bank?

46. Put all your eggs in one basket

47. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

48. Nabigla siya nang biglang napadungaw sa kanya ang isang ibon.

49. Controla las plagas y enfermedades

50. Le chien est très mignon.

Similar Words

steamships

Recent Searches

teammaisusuotcondosilacableindividualspakibigayledcomputersbabehumahangapagpapakainbilanginbangosinyongmagtrabahokumakalansingkargamagigitingstreetnakaakmalossnagawanhalu-haloguerreronobodymagkapatidnawalannagpakilalatinapayarteipantalopmayopagkapunoiskedyulayusinbarriersstrengthdumagundongunconventionalmirakarwahengsipagpronounbetweenpahiramiiwasanpagkuwansinksaysinumangnatalomalalimdaysaktanlikeskagalakanvelstandsundaekalawangingupangbutihingcapitalistbeautycardiganpinamalagiogordugoyukobinabaintroducepinangalananmaabutanlakimagkakaroonsaritamahabangalas-dosnakapaligidpawiinpaospupuntakumapitscientificngumitimagsimulaquicklyiwanannabigayinstitucioneskapagnagdadasalbooksmapaibabawkatagapolobigladumaramipatutunguhanincreasedpaghaharutanikinasasabiknaroonhojastinatanongsalbahenglansanganpitakaexhaustedelladiamondamerikatandatinyisinalangblusaaccuracydolyaranimpaglapastanganinihandaboxcorrectingshoescivilizationpelikulamustmoodbrindarsumakitpamilihang-bayanandroidpersistent,ginoongtransparentsumanglibretelevisednai-dialenviarnanunuksogreatlysabihinmangebutchkatolisismolumiitlalakingboholtulongdisenyopangalandumilimroughfactoresmaglinislumutangbosesseekpeksmansoonbusiness:departmentinasikasojingjingdibanagtaposalagangpitumponginaabotyorkpasasalamatnetflixtenidooftepublishingdagatnagingfinishedkagipitanmahiyakabutihanmonitorballcommunicatetumatawagaplicacionesibinalitangleksiyongenepanghihiyangnakasahodcurtainsmatulunginnakabanggapawiskumaengoodeveningpagdamikauri