Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

34 sentences found for "team"

1. A couple of goals scored by the team secured their victory.

2. Basketball is a team sport that originated in the United States in the late 1800s.

3. Football coaches develop game plans and strategies to help their team succeed.

4. Football is a popular team sport that is played all over the world.

5. Hockey coaches develop game plans and strategies to help their team succeed.

6. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

7. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

8. Natalo ang soccer team namin.

9. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

10. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

11. The athlete's hefty frame made them well-suited for their position on the team.

12. The basketball court is divided into two halves, with each team playing offense and defense alternately.

13. The football field is divided into two halves, with each team playing offense and defense alternately.

14. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

15. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

16. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

17. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

18. The mission was labeled as risky, but the team decided to proceed.

19. The objective of football is to score goals by kicking the ball into the opposing team's net.

20. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

21. The professional athlete signed a hefty contract with the team.

22. The project gained momentum after the team received funding.

23. The team captain is admired by his teammates for his motivational skills.

24. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

25. The team is working together smoothly, and so far so good.

26. The team lost their momentum after a player got injured.

27. The team won a series of games, securing their spot in the playoffs.

28. The team's colors are purple and gold, and they play their home games at the Staples Center.

29. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

30. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

31. The team's performance was absolutely outstanding.

32. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

33. The website's contact page has a form that users can fill out to get in touch with the team.

34. Winning the championship left the team feeling euphoric.

Random Sentences

1. She does not gossip about others.

2. Bakit ka natawa? Bakit ka nakangiti?

3. Natagpuan niya ang singsing matapos niyang salatin ang ilalim ng sofa.

4. Inakalang hindi na darating ang bus, kaya naglakad na lamang sila.

5. Ang puting pusa ang nasa sala.

6. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

7. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

8.

9. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

10. O sige na, sige na! Tumahan ka na lang!

11. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

12. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

13. Nabangga ang kotse ni Juan bandang alas-tress ng hapon.

14. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

15. Maraming Salamat!

16. Maramot ang bata sa laruan kaya walang gustong makipaglaro sa kanya.

17. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

18. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

19. Mayroon pa ho sana akong gustong itanong.

20. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

21.

22. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

23. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

24. Salamat at hindi siya nawala.

25. Nanlilimahid ang mga bata sa daan.

26. Give someone the benefit of the doubt

27. A veces la realidad es dolorosa, pero no podemos escapar de ella.

28. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

29. The exhibit features a variety of artwork, from paintings to sculptures.

30. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

31. Hindi maikubli ang panaghoy ng bata habang nilalapatan ng lunas ang sugat niya.

32. Bakit ka tumakbo papunta dito?

33. Sa purgatoryo, inaalis ng Diyos ang mga natitirang kasalanan sa mga kaluluwa bago sila tanggapin sa Kanyang harapan.

34. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

35. Hinagud-hagod niya ang mga kamao.

36. Ang daming labahin ni Maria.

37. El proceso de dar a luz requiere fortaleza y valentía por parte de la madre.

38.

39. Wala na naman kami internet!

40. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

41. El concierto de la orquesta sinfónica fue una experiencia sublime para los asistentes.

42. Sa tindi ng init, pakiramdam ko’y nagbabaga na ang lupa sa ilalim ng aking mga paa.

43. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

44. Puwede ka ba sa Miyerkoles ng umaga?

45. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

46. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

47. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

48. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

49. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

50. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

Similar Words

steamships

Recent Searches

bornteamstoreplaysinaloksatisfactionideyaumiinitninanangangahoyikinamataykagandahagkalalakihannagtitindadistansyalossmasayahinmatalinonangangaralmaihaharapbloggers,namulaklakkapangyarihangnagpapakainyumuyukoawtoritadongmagsugalnareklamomakukulaymedicaltangeksairporttaga-hiroshimadisensyohiramgatastumingalahinalungkatkastilangcombatirlas,masaganangwalisibilitatlongdiligingroceryiniangatmaibaniyosakyanitsuramatesalunesmaisipmatikmananongipinanganaknatitirabaguioomfattendepeppywifinyanarkiladasalphilippinesandaliganitoforståbulalasfourpakealammaaarinakakinaininangsoundkuyacarbonnogensindeseelingidresignationcellphonefar-reachingmadurasblazingnaggraphicmahalupangmahabangdahilagam-agammajorbinabalikmarchwowbumababalegendsmatchingtaposfeltkidlatcertainlearningcomunicarsereturnedryanquicklykubofacerelativelyperoNGUNITnatinospitalcharitablepinunitaggressionkahonperseverance,madamotipinadalasakakesomarunongcapacidadesfiaarguerawsapagkatnasisiyahanpagkagustoteknologifilipinaugalikantoginagawahahahanagsuothinampaspnilitaaisshtomorrowglobalhotelkongmonumentobingihaypasyabobopedroTuloypoongisinakripisyokabangisankawili-wilibawiantamisswimmingtinikmanbilihinisinumpasusunodataqueskombinationsinofulfillingkotsedaratingnariyankamustachavitsumindikamakailanmaximizingtilapublishing,takboitinataginiligtaspinisilisaacmagpakasalmarahilhidingindividualstocksnag-aagawanresumenisipsasapakinmalulungkottipsinantokgaanodatingcases