Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

34 sentences found for "team"

1. A couple of goals scored by the team secured their victory.

2. Basketball is a team sport that originated in the United States in the late 1800s.

3. Football coaches develop game plans and strategies to help their team succeed.

4. Football is a popular team sport that is played all over the world.

5. Hockey coaches develop game plans and strategies to help their team succeed.

6. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

7. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

8. Natalo ang soccer team namin.

9. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

10. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

11. The athlete's hefty frame made them well-suited for their position on the team.

12. The basketball court is divided into two halves, with each team playing offense and defense alternately.

13. The football field is divided into two halves, with each team playing offense and defense alternately.

14. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

15. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

16. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

17. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

18. The mission was labeled as risky, but the team decided to proceed.

19. The objective of football is to score goals by kicking the ball into the opposing team's net.

20. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

21. The professional athlete signed a hefty contract with the team.

22. The project gained momentum after the team received funding.

23. The team captain is admired by his teammates for his motivational skills.

24. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

25. The team is working together smoothly, and so far so good.

26. The team lost their momentum after a player got injured.

27. The team won a series of games, securing their spot in the playoffs.

28. The team's colors are purple and gold, and they play their home games at the Staples Center.

29. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

30. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

31. The team's performance was absolutely outstanding.

32. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

33. The website's contact page has a form that users can fill out to get in touch with the team.

34. Winning the championship left the team feeling euphoric.

Random Sentences

1. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

2.

3. Napakagandang dalaga, wika niya sa sarili at tuloy-tuloy na nilapitan niya ito.

4. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

5. It was founded by Jeff Bezos in 1994.

6. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

7. Hindi siya makabangon at makagawa ng gawaing bahay.

8. Maraming alituntunin ang ipinatutupad sa eskwelahan.

9. Ang amoy ng bagong simoy ng hangin ay napakarelaks at mabango sa amoy.

10. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

11. Mayroon umano siyang lihim na kayamanan na itinago sa loob ng maraming taon.

12. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

13. Ang paglapastangan sa mga propesyonal at kanilang propesyon ay isang paglapastangan sa kanilang dedikasyon at pagsisikap.

14. May maruming kotse si Lolo Ben.

15. Bilin ni Aling Pising na lagi niyang aayusin ang kaniyang buhok upang hindi maging sagabal sa kaniyang mga gawain at pag-aaral.

16. El agua es un tema de importancia mundial y está relacionado con el desarrollo sostenible y la seguridad alimentaria.

17. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

18. El maíz necesita sol y un suelo rico en nutrientes

19. La paciencia es una virtud que nos ayuda a ser mejores personas.

20. La película produjo una gran taquilla gracias a su reparto estelar.

21. Ibinigay ng aking mga kaibigan ang kanilang suporta at pagsuporta sa aking mga pangarap.

22. Work can also have a social aspect, providing opportunities to meet new people and make connections.

23. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

24. Pagkakataon na ni Ogor upang sumahod.

25. Hindi ko maaaring pabayaan ang aking mga agam-agam dahil ito ay maaaring magdulot ng panganib sa aking buhay.

26. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

27. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

28. Nagpunta sa kumbento si Sister Jane.

29. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

30. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

31. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

32. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

33. Keep studying and hang in there - you'll pass that test.

34. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

35. Fødslen kan også være en tid med stor frygt og usikkerhed, især for førstegangsforældre.

36. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

37. Mabuti na lamang at hindi natuloy ang sumpa.

38. Ang poot ang nagbibigay sa akin ng lakas at determinasyon upang harapin ang mga hamon ng buhay.

39. El internet ha hecho posible la creación y distribución de contenido en línea, como películas, música y libros.

40. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

41. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

42. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

43.

44. If you keep cutting corners, the quality of your work will suffer.

45. Napakalakas ng bagyong tumama sa kanilang bayan.

46. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

47. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

48. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin at hamon na kinakaharap ng mga tao.

49. The meeting was cancelled, and therefore he had the afternoon off.

50. Holy Week begins on Palm Sunday, which marks Jesus' triumphal entry into Jerusalem and the start of the Passion narrative.

Similar Words

steamships

Recent Searches

comunesteamwindowsummitinternalrecentmalaking1982regularmentenerissabringingikawsequeeffectmapexplainevolveconsiderinfinitytoolbakasyonmusiciansginugunitahealthierkahonasianakitareserbasyontinanggaparaynakasakittutungokalalakihannanunurikabarkadavaledictorianbibilipasyapulitikosikipdiscoveredpangitnamnaminsumapitpetsangkumukuhapagpapatuboiiwanpagmamanehomagkasamanagsisipag-uwianpinamalagitumangosamantalangbooksagostohumihingibahagyakahitpakilutoincomedilanakasuotcadenainisipauthorareayeahcouldipagtatapatsundhedspleje,sponsorships,salu-salopinagtagponag-iyakannakakapamasyalmang-aawitkasaganaanmanlalakbaypangungutyarevolucionadonagpapaigibvideos,naninirahanmakatulogcrucialutak-biyakalayuanmagkaibangsiniyasatmagpakasalnapaiyakkahaponinirapandisenyongtinangkakinauupuangnahawakannaka-smirkkinagalitantinatawagnakaka-inconsideredkalaropamasahemauliniganyakapinricalalabaspanalanginnagbibigaynagcurvedaramdaminnag-emailkuwentopaghangapagkagisingprodujobalediktoryanmagtigilengkantadangtinawagbinuksansugatanginilabasmagawaapelyidoipinauutangpinagsikapanbumaligtadmakapaltumamacynthiadireksyontalinokargahanvictoriamatagumpaynagbibigayantsismosaimprovementiikotpinalambotpanunuksochristmasbihirakonsyertosuriinlalocalidadmerchandiseturonlubosnakabiladbantulotkutsaritangebidensyasarongmagnifykasalpinatiramaisipdespueskainisadecuadoalmacenarsayawanmagdaraoskalongincidencebalatumalislagunanagyayangtiniknyanaddictionkirotmagbibigaythirdletterlumulusobopomalamangsonidofrescoaffiliatemanghulimalikotwidelyganamakasarilinglugartilltransmitssandalingbilaoiatfinantaymust