Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

34 sentences found for "team"

1. A couple of goals scored by the team secured their victory.

2. Basketball is a team sport that originated in the United States in the late 1800s.

3. Football coaches develop game plans and strategies to help their team succeed.

4. Football is a popular team sport that is played all over the world.

5. Hockey coaches develop game plans and strategies to help their team succeed.

6. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

7. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

8. Natalo ang soccer team namin.

9. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

10. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

11. The athlete's hefty frame made them well-suited for their position on the team.

12. The basketball court is divided into two halves, with each team playing offense and defense alternately.

13. The football field is divided into two halves, with each team playing offense and defense alternately.

14. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

15. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

16. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

17. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

18. The mission was labeled as risky, but the team decided to proceed.

19. The objective of football is to score goals by kicking the ball into the opposing team's net.

20. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

21. The professional athlete signed a hefty contract with the team.

22. The project gained momentum after the team received funding.

23. The team captain is admired by his teammates for his motivational skills.

24. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

25. The team is working together smoothly, and so far so good.

26. The team lost their momentum after a player got injured.

27. The team won a series of games, securing their spot in the playoffs.

28. The team's colors are purple and gold, and they play their home games at the Staples Center.

29. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

30. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

31. The team's performance was absolutely outstanding.

32. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

33. The website's contact page has a form that users can fill out to get in touch with the team.

34. Winning the championship left the team feeling euphoric.

Random Sentences

1. Skærtorsdag mindes Jesu sidste nadver med sine disciple, før han blev taget til fange.

2. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

3. Kumusta ang nilagang baka mo?

4. Elektronik kan hjælpe med at forbedre adgangen til information og vidensdeling.

5. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

6. Dedication to personal growth involves continuous learning and self-improvement.

7. My favorite thing about birthdays is blowing out the candles.

8. Maganda ang mga bulaklak sa tagsibol.

9. Bumibili ako ng maliit na libro.

10. Ang laki ng sawa na kanyang nakita.

11. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

12. There are many different types of microscopes, including optical, electron, and confocal microscopes.

13. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

14. Nag-aalala ako sa mga pinagdadaanan ng aking nililigawan at lagi kong inuunawa ang kanyang mga kailangan.

15. Naaksidente ang aming plano sa bakasyon dahil sa pagbaha sa lugar na aming pupuntahan.

16. Mange steder i Danmark afholdes der påskeoptog og andre offentlige begivenheder i løbet af Holy Week.

17. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

18. Emphasis is an important tool in public speaking and effective communication.

19. Eh? Considered bang action figure si spongebob?

20. Hinugot niya ang kanyang kaisipan upang makaisip ng magandang solusyon sa problema.

21.

22. Inirapan ko na lang siya saka tumayo.

23. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

24. Pumuslit ang luha sa sulok ng kanyang mga mata.

25. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

26. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

27. Bawat umaga, ako'y bumabangong maaga para maglakad sa dalampasigan ng karagatan.

28. Hindi ako maaring abutan ng hatinggabi, kapag hindi ako umalis ngayon ay hindi na ako makakabalik pa sa amin.

29. Nakita niya ang nagbabagang bulkan mula sa malayo, nagpapakita ng lakas ng kalikasan.

30. La alimentación equilibrada y una buena hidratación pueden favorecer la cicatrización de las heridas.

31. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

32. Naglaba na ako kahapon.

33. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

34. Emphasis can help to ensure that a message is received and understood by the intended audience.

35. Si Hidilyn Diaz ay tinawag na “Pambansang Bayani” sa larangan ng palakasan.

36. Naglalaway ang mga aso sa amoy ng pagkain na inilabas sa kusina.

37. The website's contact page has a form that users can fill out to get in touch with the team.

38. If you don't want me to spill the beans, you'd better tell me the truth.

39. Uwi na tayo.. Ayoko na dito sa ospital..

40. Bis später! - See you later!

41.

42. Pagkakataon na ni Ogor upang sumahod.

43. ¡Hola! ¿Cómo estás?

44. Papaano ho kung hindi siya?

45. Ang mga bayani ay nagpapakita ng disiplina at determinasyon sa paglutas ng mga problema ng bayan.

46. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

47. Ngunit wala siyang nararamdaman sakit.

48. Hinde ko dala yung cellphone ni Kenji eh.

49. Ailments are physical or mental health conditions that cause discomfort or illness.

50. Ano na nga ho ang pamagat ng palabas ninyo?

Similar Words

steamships

Recent Searches

ipasokcommunicationspressteambinasasourceulingconstitutionrefnapakalakinggraduallyactorlearnexamplekanocenterkunwana-curiousnag-iisasinakopteachingsglobalnabuhaymagtakamakapag-uwireboundattentionmakasilongferrerprivatemestloanshuertoshoppinghahatolpamasahestordomingodeterminasyonpierlugarbangkangkaninarawtaposmagkanomasayahindalirimalulungkotpag-uwishinescorporationwalkie-talkiekuligligevenfredheietograbeauthorexitboyataquescountriesspeedtravelernagwelgangingisi-ngisingnagre-reviewnapakagandangmagkasintahannakatuwaangpagkamanghanagkakasyasportsnatanggappinagsikapanpotaenanegro-slavesunahinmagkapatidpagpilisimbahangulatskills,tatawagannapapasayapamilyangnapakagagandaherundertumatanglawmakikiligoromanticismopalancapagkasabinagmadalingnanlakiatensyongmagtataaskanikanilangnagmistulangmahuhulinapakabilispasaheronanonoodnakilalamangyarinapahintonatatawakuripotfactoresvidenskabrichkondisyonpinigilandispositivohulutv-showslabinsiyamnagdadasalbisitanamatayforskel,nareklamoapatbiyasmahahawatanghalivictoriabilihintradisyonproducererpantalonindustriyanakaakyatcombatirlas,gumigisingvegasebidensyaginoongfollowedtiranglalotakotporxviiemocioneskalabanlugawlalakingadecuadoflamencotagakdisciplinalagaomfattendeannikabayaningcredittatlongninaanaybingimukapabalangalaalamalihismalayanglumulusobkinantakahilingankaarawankasoylihimnamulatpublicitysumpainpinalayasnaalisisinumpagrowthlangkaykainissinaedsapasensyaideatoyinataketiningnanenergimaistorbonatulognenawikamakinangitinuturingtinaposritwallumaban