Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

34 sentences found for "team"

1. A couple of goals scored by the team secured their victory.

2. Basketball is a team sport that originated in the United States in the late 1800s.

3. Football coaches develop game plans and strategies to help their team succeed.

4. Football is a popular team sport that is played all over the world.

5. Hockey coaches develop game plans and strategies to help their team succeed.

6. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

7. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

8. Natalo ang soccer team namin.

9. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

10. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

11. The athlete's hefty frame made them well-suited for their position on the team.

12. The basketball court is divided into two halves, with each team playing offense and defense alternately.

13. The football field is divided into two halves, with each team playing offense and defense alternately.

14. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

15. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

16. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

17. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

18. The mission was labeled as risky, but the team decided to proceed.

19. The objective of football is to score goals by kicking the ball into the opposing team's net.

20. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

21. The professional athlete signed a hefty contract with the team.

22. The project gained momentum after the team received funding.

23. The team captain is admired by his teammates for his motivational skills.

24. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

25. The team is working together smoothly, and so far so good.

26. The team lost their momentum after a player got injured.

27. The team won a series of games, securing their spot in the playoffs.

28. The team's colors are purple and gold, and they play their home games at the Staples Center.

29. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

30. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

31. The team's performance was absolutely outstanding.

32. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

33. The website's contact page has a form that users can fill out to get in touch with the team.

34. Winning the championship left the team feeling euphoric.

Random Sentences

1. Habang naglalakad sa gabi, nabigla siya sa biglang pagkabagsak ng mga paputok.

2. La realidad siempre supera la ficción.

3. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

4. Ang kanyang bahay sa Kawit ay isa na ngayong pambansang dambana.

5. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

6. When in Rome, do as the Romans do.

7. Mayoritas penduduk Indonesia memeluk agama Islam, yang merupakan agama mayoritas di negara ini.

8. Lumapit siya sa akin at sumandal sa may sink.

9. All these years, I have been discovering who I am and who I want to be.

10. Tak ada gading yang tak retak.

11. Kailangan ko ng lumisan mahal ko.

12. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

13. Gaano katagal ho kung sasakay ako ng dyipni?

14. El romero es una hierba aromática que se usa frecuentemente en la cocina mediterránea.

15. Me gusta mucho dibujar y pintar como pasatiempo.

16. Mas maliit ang bag ko sa bag ni Cassandra.

17. Chris Hemsworth gained international recognition for his portrayal of Thor in the Marvel Cinematic Universe.

18. The information might be outdated, so take it with a grain of salt and check for more recent sources.

19. Einstein's legacy continues to inspire scientists and thinkers around the world.

20. La formación y la educación son importantes para mejorar las técnicas de los agricultores.

21. Nasa unibersidad si Clara araw-araw.

22. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

23. Ingatan mo ang cellphone na yan.

24. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

25. Lahat ng tao, bata man o matanda, lalake at babae, ay tumaba.

26. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

27. Kinuha nito ang isang magbubukid at agad na nilulon.

28. Hvis man oplever smerter eller ubehag under træning, er det vigtigt at stoppe og konsultere en sundhedsprofessionel.

29. La creatividad se puede aplicar en cualquier campo de trabajo.

30. Starting a business during an economic downturn is often seen as risky.

31. Nagliliyab ang mga damo sa bukid dahil sa sobrang init ng panahon.

32. Elektronik kan hjælpe med at forbedre miljøbeskyttelse og bæredygtighed.

33. 5 years? naramdaman ko yung pag iling niya, 1 year..?

34. At sana nama'y makikinig ka.

35. Maraming tao ang naniniwala sa kakayahan ng albularyo kahit hindi ito lisensyado.

36. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

37. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

38. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

39. The king's court is the official gathering place for his advisors and high-ranking officials.

40. El arte puede ser utilizado para fines políticos o sociales.

41. All these years, I have been building a life that I am proud of.

42. Some dog breeds are better suited for certain lifestyles and living environments.

43. Gustong pumunta ng anak sa Davao.

44. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

45. Ano ang paborito mong pagkain?

46. Soto ayam adalah sup ayam yang dimasak dengan rempah-rempah Indonesia khas.

47. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

48. A father is a male parent in a family.

49. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

50. It is an important component of the global financial system and economy.

Similar Words

steamships

Recent Searches

teammoviesiwinasiwasnoongbuenanegosyanteturismoamuyinmakikitanabalitaannapatulalanananalongtagpiangtangeksnahawaagostonahulaanuulaminworldginagawawayspaghalakhakperlamagkasabaycontent:cigarettefurynanaytiniklingkwenta-kwentatapatrailbipolarkumalmasumakaydeviceskongresoumiilingmakauuwikangitanmag-uusapmulisamuneverlabinsiyamyonfacebooknagmistulangdisappointnagmadalingayankilokailangantinderapagkaingprobablementenaglabananmagkakagustomabilisnagpakunotsakop3hrspositibonatinreleasedfuncionespinaladaccedermanahimikmanuksohouseholdtracklumibotprogramming,rawmamanhikannakapagsabipamburadyipninakukuhamontrealpalancapolonakaraanpinag-aaralannagdiretsogeneratedlabingpagkakayakaplumindolpagetrycyclemakilinginiwannapaplastikankonsyertotreatslaamangindustryteknologisistercommercialyoutube,reviewtrabahomedicalpersonasproductividadroofstocksportssnahanmabibingiteachermarketplacesipinansasahogdogpapuntangpookpapayabagkustiemposipinangangakerlindameaningmabihisantinakasansaanpetsangcapacidaddibatinahakhikingnakatapattradepinabulaannagsmilepakakasalanhandaanbaku-bakongtilabakantesalaminsugatangbecomemaglalakadeventsroboticsteerlarangantienenpelikulapinaghatidantingsubjectbagaypinahalataipinamilipagkagisinglandlinepalabuy-laboyrevolutioneretkalabanbumilipagpapatuboconsumeniyanpangittherapeuticssciencepaki-ulitalasbinulongnakakadalawkomunikasyonbuung-buoipagtimplanaguguluhanpaumanhindennegiyeranatandaanmurang-muraibinigaynaguguluhanginilistaibonleemagkahawakpaghihingalokalalaroumuwisitawninanaisinstrumentalnasisiyahanhappenede-commerce,kapecontent,