Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "view"

1. I absolutely agree with your point of view.

2. Pangit ang view ng hotel room namin.

3. Some people view money as a measure of success and achievement, while others prioritize other values.

4. The hotel room had an absolutely stunning view of the city skyline.

5. The sunset view from the beach was absolutely breathtaking.

Random Sentences

1. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

2.

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

4. Le chien est très mignon.

5. Hindi lahat ng tao ay bukas palad, kaya kailangan mong mag-ingat sa mga taong pwede kang masaktan.

6. A lot of time and effort went into planning the party.

7. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

8. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

9. Ang kanyang mga galaw ay tila naglalayo ng loob ng iba, palayo sa kanya.

10. May notebook ba sa ibabaw ng baul?

11. Sambal adalah saus pedas yang terbuat dari cabai dan bumbu-bumbu lainnya.

12. Naramdaman ko ang kanyang malalim na halinghing sa telepono.

13. Pumasok sa pintuan ang mga atleta nang limahan bago magsimula ang laro.

14. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

15. Mahilig si Tatay manood ng laro kung saan ang gamit ay bola.

16. Cancer can impact individuals of all ages, races, and genders.

17. Natayo ang bahay noong 1980.

18. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

19. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

20. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

21. Nagsisigaw siya nang makitang wala pang hapunan.

22. Maari mo ba akong iguhit?

23. Pakibigay sa akin ang listahan ng mga kailangan nating bilhin sa palengke.

24. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

25. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

26. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

27. If you're trying to get me to change my mind, you're barking up the wrong tree.

28. Oh gosh. Inintay pa sya ng prince, what does it mean?

29. Nakasuot ng pulang blusa at itim na palda.

30. Dedication is what separates those who dream from those who turn their dreams into reality.

31. The awards ceremony honored individuals for their charitable contributions to society.

32. Las labradoras son muy leales y pueden ser grandes compañeros de vida.

33. Nagkantahan kami sa karaoke bar.

34. Nag-reply na ako sa email mo sakin.

35. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

36. They have bought a new house.

37. L'intelligence artificielle peut aider à la conception de médicaments plus efficaces.

38. Makapiling ka makasama ka.

39. The zoo houses a variety of animals, including lions, elephants, and giraffes.

40. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

41. Ang lakas mo uminom wala ka naman ambag.

42. Halos gawin na siyang prinsesa ng mga ito.

43. Ang mga nagliliyab na bulaklak sa hardin ay nagbigay ng makulay na tanawin.

44. Portion control is important for maintaining a healthy diet.

45. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

46. Seek feedback, it will help you to improve your manuscript

47. Es importante leer las etiquetas de los alimentos para entender los ingredientes y la información nutricional.

48. Limitations can be a result of fear or lack of confidence.

49. Ang mga kabataan ay kailangan ng edukasyon tungkol sa mga masamang epekto ng pagkakaroon ng sira sa ngipin at hindi pagpapatingin sa dentista.

50. Nagka-cutting classes ako kanina dahil biglaang nagkasakit ako.

Similar Words

Nagre-reviewviewsre-reviewteleviewingoverviewreviewinterviewingreviewers

Recent Searches

vieweachinternalforskelligeaksidentedemocracymahilignakatindigspeechdavaoeksempelasinuponimporhistorypananimprutasnaglipanangkasangkapanpare-parehomagkakailamakikipag-duetomagtatagalsarapmakapaibabawnaglalatangikinatatakotnakaramdamwidespreadnag-angatmakuhangkapasyahankalayuanpaki-drawingpinakamahabamakapagsabitatlumpungprodujonapatulalapaghahabimananalobwahahahahahayakapinpambatangmagdoorbellmaputilawaypakakasalanmaglaroautomatisknaaksidentenakakaanimnagtataehurtigerenai-dialpaalamsteamshipsiniresetasumalakayempresasika-12kainitantumatawadnanlilimahidhelenacaraballopaglayastiranghinugotsasapakinnaawalunaspaggawaopportunityhinampascoughingsisentakumaentagalsongsexpertisemonitorsapotcubiclebutidialledhinintaykaybiliscalidadmaximizinghumanscassandraasthmainantaypresyobilibmakahinginasannahigalossfar-reachingbio-gas-developingcomunicangrinskatedraltresinombobomesangcongressknowndollyramdamgrewfiatodaycalambabaledrayberdaysjanechadcardnuonkasalukuyandaykingsumaliyoungurichangewatchbroadbakebringdownlightssagingjoysharenicecontinuedechaveapollosamasquatterboxseveralkulunganbituininteractneedsclienteinteligentesinterviewingdraft,kawili-wilikalakihannakangitingdisyemprebibisitakwenta-kwentapagkalitoinaamint-shirtintroducephysicalnapakatalinonakabluetagpiangapatnapuclassroomunangmaynilagawingsakop3hrsipinansasahogkumikinighitkisapmatawednesdayguidanceestatetengakingdommarmainginiibigpinagtabuyanharireducedmatabaroquestanddollarreleasedbeyondmaratingpagsusulitpsh