Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "cryptocurrency:"

1. Bitcoin is the first and most well-known cryptocurrency.

2. Cryptocurrency can be used for both legal and illegal transactions.

3. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

4. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

5. Cryptocurrency has faced regulatory challenges in many countries.

6. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

7. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

8. Cryptocurrency is often subject to hacking and cyber attacks.

9. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

10. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

11. Cryptocurrency operates independently of central banks and governments.

12. Cryptocurrency wallets are used to store and manage digital assets.

13. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

14. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

15. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

16. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

17. Some businesses and merchants accept cryptocurrency as payment.

18. Some people invest in cryptocurrency as a speculative asset.

19. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

20. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

21. The value of cryptocurrency can fluctuate rapidly due to market forces.

Random Sentences

1. Dogs can provide emotional support and comfort to people with mental health conditions.

2. Para sa kaibigan niyang si Angela

3. Owning a pet can provide companionship and improve mental health.

4. Frohe Weihnachten! - Merry Christmas!

5. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

6. Naglaro ako ng soccer noong Oktubre.

7. Lumampas ka sa dalawang stoplight.

8. If you keep cutting corners, the quality of your work will suffer.

9. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

10. Stuffed Toys, Mini-Helicopter, Walkie-Talkie, Crush Gear, Remote Controlled Cars, at higit sa lahat, ang Beyblade.

11. Ang galing nya maglaro ng mobile legends.

12. Ang mga hayop sa gubat ay naglipana din.

13. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

14. I admire the perseverance of those who overcome adversity.

15. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

16. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

17. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

18. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

19. Smoking is a harmful habit that involves inhaling tobacco smoke into the lungs.

20. Hinintay kong magsalita si Kuya Patrick sa kabilang linya.

21. Bilang paglilinaw, ang parangal ay ibibigay sa buong grupo, hindi lamang sa isang tao.

22. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

23. The judicial branch, represented by the US

24. Cada año, la cosecha de manzanas en esta región es muy buena.

25. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

26. Users can follow other accounts to see their tweets in their timeline.

27. Ang tubig-ulan ay mahalaga sa pagpapalago ng mga halaman at hayop.

28. Imulat ang isipan sa mga kulay ng buhay.

29. Kepulauan Raja Ampat di Papua adalah salah satu tempat snorkeling dan diving terbaik di dunia.

30. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

31. Tak kenal maka tak sayang.

32. The company had to cut costs, and therefore several employees were let go.

33. Les patients peuvent avoir besoin de soins psychologiques pendant leur hospitalisation.

34. Sino pa, isisingit ni Ogor, di si Dikyam!

35. Les hôpitaux peuvent être des environnements stériles pour prévenir la propagation des infections.

36. He admires his friend's musical talent and creativity.

37. Lumabas ng simbahan ang mga tao nang limahan matapos ang misa.

38. Dali-daling umalis ang binata patungo sa palasyo.

39. La conciencia nos ayuda a ser responsables de nuestras acciones y decisiones.

40. Don't waste your money on that souvenir, they're a dime a dozen in the market.

41. El realismo y el impresionismo son estilos populares en la pintura.

42. La música es una forma de arte que se disfruta en todo el mundo.

43. Inilabas ng guro ang kanyang laptop sa silid-aralan upang ipakita ang kanyang mga presentasyon.

44. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

45. Nang maglakad ako sa tabing-dagat, nakakita ako ng mga maliliit na alon na mayabong na puting espuma.

46. Ang taong mapagbigay, sa kapwa ay may kapatid.

47. Ang mailap na mga bagay ay kadalasang may halaga dahil sa kanilang kakaibang katangian.

48. Debemos tener una buena comprensión de la realidad para tomar decisiones informadas.

49. O sige na nga, diba magkababata kayo ni Lory?

50. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

Recent Searches

cryptocurrency:shadesdragonsatisfactionngpuntamalaboipinikitsinongmungkahiotrokaninangsakasumibolsuotpinagbigyanmasayapagbigyanmasaktanmangginawaranthirdbinilingsensiblemessagepublishedevolvecontrolamediumquicklycallingshowcityelepanteumaapawdiyanumanomaalogmadalihelloaniforskelligehinilaresultmatulungindamikablanleddurianmakipagtalopagkapasannilangresearch:caraballopinapakiramdamananak-pawisbosesbabayaranboteomfattendekinainkananmensaheitinulosalituntuninmag-aaralngunittarangkahan,goodeveningbedsidepaki-basananoodmahahanaytuluyanimportantekaharianisdanghalamanpamahalaanbanalininomipinagdiriwangbluebumabalotpinagtabuyansasabihinbahagililigawanmatindilorywakastssspatakbongnakitapatimamayamagsi-skiingitomalimitharapanpalantandaannagpabayadpakisabigitanaseksportenkasamapang-araw-arawnag-ugatkapangyahiranphilosophernagwagibayaningbangladeshinternetsapagkatantibioticsmangungudngodnakagawiankulogpagtitindanaguguluhangindustriyafinishedtumawatawagmagpapabunotnakakapasokbatangtilkupasingsalattrabajargathertrenminamasdankapatidilanbaomagtanghalianerankapangyarihanmangangalakalipagtimplasusunodtumatawasignkomedordulotitinuringzamboanganasasakupanpulisnakapagproposemarketingmagsunoglubosiniirogworddeletingditotuloy-tuloyibonpaskokamakailanspeedpagawainpampagandaalamidkakayanan4thgabipromotechristmastumaggapagam-agamthementrynag-uwiyearsoverallnatinsumuboproductsmakasamanamalagilaliminfluentiallabanmakapilingcallbutinagkikitanangangaralinferioresbusiness:pagtataposnagsisigaweskwelahanpagpasensyahanngingisi-ngisingassociation