Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "cryptocurrency:"

1. Bitcoin is the first and most well-known cryptocurrency.

2. Cryptocurrency can be used for both legal and illegal transactions.

3. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

4. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

5. Cryptocurrency has faced regulatory challenges in many countries.

6. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

7. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

8. Cryptocurrency is often subject to hacking and cyber attacks.

9. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

10. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

11. Cryptocurrency operates independently of central banks and governments.

12. Cryptocurrency wallets are used to store and manage digital assets.

13. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

14. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

15. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

16. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

17. Some businesses and merchants accept cryptocurrency as payment.

18. Some people invest in cryptocurrency as a speculative asset.

19. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

20. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

21. The value of cryptocurrency can fluctuate rapidly due to market forces.

Random Sentences

1. Maramot siya sa pagkain kaya hindi niya binibigyan ang kanyang mga kapatid.

2. Ang mga anak-pawis ay nangangailangan ng patas na pagkakataon upang magkamit ng tagumpay at umangat sa buhay.

3. Sige na. Kami na lang bahala dito. sabi sa akin ni Grace

4. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

5. Nahihilo ako dahil masyadong mainit ngayon.

6. Kailangang pag-isipan natin ang programa.

7. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

8. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

9. Kaninang umaga ay bumigay na ng tuluyan ang kanyang katawan, wala ng nagawa ang mga doktor.

10. Binibigyang halaga ng mga Pilipino ang talambuhay ni Dr. Jose Rizal bilang isang pambansang bayani.

11. Sige maghahanda na ako ng pagkain.

12. Dahil sa magandang boses at musika, nahuhumaling ako sa panonood ng mga musical plays.

13. Ang pagmamalabis sa pag-inom ng alak ay maaaring magdulot ng mga problemang pangkalusugan at personal.

14. Pantai Kuta di Bali adalah salah satu pantai terkenal di dunia yang menawarkan pemandangan matahari terbenam yang indah.

15. Tila masaya siya, ngunit may lungkot sa kanyang mga mata.

16. Nagising ako sa marahang pagtayo ni Maico.

17. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

18. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

19. We have been cleaning the house for three hours.

20. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

21. Las fiestas invernales, como el Día de Reyes, traen alegría y celebraciones.

22. Sampai jumpa nanti. - See you later.

23. Inakalang masama ang panahon, pero biglang sumikat ang araw.

24. Ang sugal ay isang bisyong maaaring magdulot ng malaking pinsala sa buhay ng isang tao.

25. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

26. Las noticias en línea pueden ser actualizadas en tiempo real.

27. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

28. Bilang isang guro, mahalaga ang aking kamalayan sa mga pangangailangan ng aking mga mag-aaral upang magtagumpay sila sa kanilang pag-aaral.

29. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

30. La obra de Leonardo da Vinci es considerada una de las más importantes del Renacimiento.

31. Bye! liliko na sana ako para mag-iba ng exit.

32. La práctica hace al maestro.

33. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

34. Di ko sya maistorbo dahil sya ay nag-aaral pa.

35. Nagsmile siya sa akin at ipinikit niya ulit yung mata niya.

36. Hindi niya gustong maging nag-iisa sa buhay.

37. Biglang lumiwanag ang paligid at si Ipong ay naging hipon.

38. Sa facebook kami nagkakilala.

39. Maganda ang tanawin sa dagat tuwing takipsilim.

40. Anong wala! pasinghal na sabi ni Aling Marta

41. Napahinga ako ng malakas kaya napatingin siya sa akin

42. Ano ang gagawin mo sa Linggo?

43. Pangit ang view ng hotel room namin.

44. Hindi maganda ang kanilang plano kaya ako ay tumututol dito.

45. Ako ang mas nagulat nang hapasin ni Maico sa hita si Mica.

46. The symptoms of pneumonia include cough, fever, and shortness of breath.

47. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

48. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

49. This is not the time to fall apart, pull yourself together and think clearly.

50. Ang takip-silim ay isang magandang panahon para mag-unwind at mag-isip-isip sa mga bagay-bagay.

Recent Searches

palapitcryptocurrency:tabaschaddalandanmakilingpeternicenapalitangpagtatanimnauliniganmagtiwalanangangalitnecesarionapakasipagnagdiretsonakatalungkoatensyongmusicianmagpalibreanibersaryomerlindacultivarnakapaligidmonsignorunti-untibestfriendhila-agawaneskwelahannananaghilipamamasyalcompanypagbigyanunidoskinalakihankinalalagyanlondontumalonlumabassimulanagsamasiguradomauupomahirapkapintasangpaidnasagutanmasaktannakilalamangingisdangnilaosgawaingganapinnatanongtherapeuticslibertybasketbolpagbabantahinagismaskarakabighapasahekilaymadadalaawitantsonggopapayarabonakamakailanantesbankipinangangaktiranglugawumabothihigitunconventionaltangingpagdamitawananpaketeamendmentspangakonapakahumabolomfattendesarongnagisingproducts:inimbitamayabongatensyonmatamannararapatkunwamayamangvetonuhibinalitangstruggledkontingnogensinderisenaiinitanbateryapawisboksingpaghingimustniligawanreachbumabahaexhaustedindiasemillashmmmspareiniwantapatitinagoblazingamobusogattentionlagicompostelapolotaposbagyoaywandiamondroomsiemprepopcorncuentanhallfacebook1980samfundeventsmegetbook:procesostudentslastinglibreochandolaterfanspasokilandrewpromotingcreationmuchlabananimagingbabemaputidinalaboxagepracticadobringinfinityrequiresolidifysourcerepresentedcirclesummitandrepersistent,kanlurankategori,abovestyrenakapapasongkapangyarihannagpakunotnakatindigmakapaniwalapwestosalitangstarted:kindlebilhinasinbulaklakspecializeduponlightssonglapisdaladalabinilingpanopaghangacausesiginawad