Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "sources"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

4. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

5. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

6. Make sure to keep track of your sources so that you can properly cite them in your book

7. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

8. The information might be outdated, so take it with a grain of salt and check for more recent sources.

9. The scientific community is working to develop sustainable energy sources to combat climate change.

Random Sentences

1. Sa ganang iyo, may pag-asa pa ba ang ating mundo sa kabila ng lumalalang polusyon?

2. Pagdating namin dun eh walang tao.

3. The potential for human creativity is immeasurable.

4. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

5. Ayoko na pong maging pabigat sa kanila.

6. Seek feedback, it will help you to improve your manuscript

7. Mayroong nakawan sa bahay namin kahapon, pero aksidente namin naabutan ang mga magnanakaw.

8. Ang salarin ay nahuli matapos ang matagal na manhunt ng mga awtoridad.

9. The company acquired assets worth millions of dollars last year.

10. Ano ang binili mo para kay Clara?

11. Ang nakakalungkot na balita ay nagdulot ng malalim na naghihinagpis sa buong komunidad.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

14. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

15. Naglaro sa palaruan ang mga bata nang limahan.

16. Los motores de búsqueda nos permiten encontrar información específica en línea.

17. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

18. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

19. Ang laki ng sawa na kanyang nakita.

20. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

21. Alas-diyes kinse na ng umaga.

22. Sa mga liblib na lugar, ang mga punong-kahoy ay nagbibigay ng sapat na kahoy para sa mga pangangailangan sa konstruksiyon at pang-araw-araw na gawain.

23. Pahiram ng iyong mga notepads at ballpen para sa aking meeting.

24. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

25. Pumupunta ako sa Laguna tuwing Mayo.

26. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

27. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

28. Está claro que el equipo necesita mejorar su desempeño.

29. Naglalaway ako sa amoy ng niluluto mong adobo.

30. The website's design is sleek and modern, making it visually appealing to users.

31. Las serpientes hibernan durante los meses más fríos del año, reduciendo su actividad metabólica y buscando refugio en lugares protegidos.

32. Baka puwedeng hiramin mo ang iyong lawnmower para ayusin ang aking bakuran.

33. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

34.

35. Napakabilis ng wifi sa kanilang bahay.

36. I am writing a letter to my friend.

37. Ang pagiging maramot ay hindi maganda lalo na kung may nangangailangan.

38. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

39. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

40. When it comes to politics, it can be tempting to bury your head in the sand and ignore what's going on - after all, ignorance is bliss.

41. Naglipana ang mga isda sa malalim na bahagi ng dagat.

42. Who are you calling chickenpox huh?

43. Mauupo na lamang siya sa kanyang balde.

44. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

45. Sa pag-aaral, mas nagiging matiwasay ako kapag maayos ang aking mga talaarawan.

46. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

47. Agradezco profundamente tu dedicación y esfuerzo.

48. Ang mobile legends ay sikat na sikat sa mga pinoy.

49. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

50. Pede bang dito ka na lang sa tabi ko matulog?

Similar Words

resources

Recent Searches

inakalasourceskanilaetokarnabalimbesangaltumatanglawreaksiyonmakikipagbabagnaglalaroingataninfusioneskainitannaghilamospawiinipapainithinihintaynakakadalawtalentkagipitanmagtatagalsementonetflixdalagangmaanghangbingbingpagtataasdoonkingdomcolorusuariomatipunodiagnosticguiltykainpagbabayadkutsilyoipatuloylikelymagbabayadkahittubigreservationintramurosnagkapilatkaarawanrewardingnagmistulangminatamismagsusunurankubokumbentosakalingtechniqueskamiaspresence,pinapataposgenematapobrengnakapagsabiskirtkagandahanelectionsafternoonopgaver,marinigwestpanindapagluluksakusinerokatulongpodcasts,tradisyonnakikitangbangkanganumangdaysmumuntingpalitanbumigaynakakapagpatibaylaylaybeintenagbungakaaya-ayangpiyanobienfeelsikatlaruanpaglalababalinganradiomeanmagkahawakflamenconakakagalingpasanghopenabiawangnagbibigaynag-alalamagbaliktsakapaglayasnahulogiilankapainwastepaggawaviscleartanoddintsaaanywherepulisninongpilingmaintindihankakataposnakapikitmasaraphugisnapasubsobmestinalisguestsprosesokoneksequeputingnaghihirapiosinteligentesclassesnakaliliyongcreatemarielrestminu-minutoteachmanuscriptnapipilitanaaisshdettebabastoplightniligawanimpactbobofiamarketplacesempresassang-ayonunconstitutionalumupopeksmanaltmagdoorbellnahuhumalingnuonpinahalataidiomagustongcaraballootropinaulanangandatrainingibinilibinigayeffortsriyanpananakitlintekdiyaryoconclusiontinanggalmahahawamalawakrabeeeeehhhhnagtungomagkasinggandaworryculpritlamesakamaygawingdumikasalanantungkoliyongpasinghalumarawipinatawgusalipasko