Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "sources"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

3. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

4. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

5. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

6. Make sure to keep track of your sources so that you can properly cite them in your book

7. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

8. The information might be outdated, so take it with a grain of salt and check for more recent sources.

9. The scientific community is working to develop sustainable energy sources to combat climate change.

Random Sentences

1. Lumayo siya sa amin, waring nais niyang mapag-isa.

2. Lalong nag-iyakan ang dalawang bata.

3. Dahil sa kanyang natatanging kakayanan, naging tanyag ang bata sa iba't ibang lupalop.

4. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

5. Ang sugal ay naglalayo sa mga tao sa kanilang mga responsibilidad at mga mahahalagang gawain sa buhay.

6. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

7. Ang paglutas ng mga palaisipan ay nakakatulong sa pagpapalawak ng kaalaman at kakayahan sa pagpapasya.

8. El que espera, desespera.

9. Hay naku, kayo nga ang bahala.

10. Puwede bang pahiram ng konting oras mo para mag-usap tayo?

11. Ngumiti siya sa akin saka nagsalita.

12. Nagalit ang diwata sa ginawa ng madamot na matanda.

13. Money is a medium of exchange used to buy and sell goods and services.

14. Durante las vacaciones de otoño, visitamos viñedos para la vendimia.

15. Les personnes âgées peuvent être en bonne santé ou avoir des problèmes de santé.

16. I am not listening to music right now.

17. Claro, puedes contar conmigo para lo que necesites.

18. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

19. Pinakain ni Rose si Mrs. Marchant ng almusal.

20. Habang wala pang trabaho ay matuto kang magtiis na asin ang ulam.

21. He admires the athleticism of professional athletes.

22. Nakipagtagisan sya ng talino sa kapwa estudyante.

23. Pinasalamatan nya ang kanyang mga naging guro.

24. El equipo de recolección mecánico es muy eficiente para cosechar grandes extensiones de tierra.

25. Kailangan mong matuto ng pagsusuri upang mas maintindihan ang kaibuturan ng isang sitwasyon.

26. Salatin mo ang ibabaw ng mesa para makita kung may alikabok.

27. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

28. Ang taong na-suway sa kautusan ay maaaring pagmultahin o parusahan.

29. His administration pursued a more confrontational stance towards countries like China and Iran.

30. Nakita rin kita! ang sabi niyang humihingal

31. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

32. Bumoto ka nang ayon sa idinidikta ng iyong puso.

33. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang ligawan?

34. Kalaro ni Pedro sa tennis si Jose.

35. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

36. En invierno, los animales suelen hibernar para protegerse del clima frío.

37. Disculpe señor, señora, señorita

38. Walang sinumang nakakaalam, sagot ng matanda.

39. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

40.

41. Pakibigay mo ang mangga sa bata.

42. Ang Mabini Shrine ay matatagpuan sa Talaga, Tanauan, Batangas.

43. Mi novia y yo celebramos el Día de los Enamorados con una tarde de películas románticas en casa.

44. Nagalit ang matanda at pinalayas ang babaeng madungis.

45. Ibinigay ni Ana ang susi sa kanya.

46. Ito na yata ang pinakamatabang babae na nakilala niya.

47. She enjoys cooking a variety of dishes from different cultures.

48. May isinulat na sanaysay ang isang mag-aaral ukol kay Gabriela Silang.

49. Money can take many forms, including cash, bank deposits, and digital currencies.

50. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

Similar Words

resources

Recent Searches

sourcesnakakalayomatapobrengpinagwikaannagbantaysabiestablishedpacemarkednasundocesnagsimulautosikinakatwiranrangepamamalakadnaramdamfilmculturestumikimnausalnamuhaynakabuklatmacadamialumayobahaarturosampungprovidedproductionpinauupahangpinabulaanpamumunopamilihang-bayanpakealampaglalaitpagkuwanapakagalingnapatigilnagngangalangdoble-karanaglalambingmininimizemaunawaanmapa,maghintaymadamingmagturolungkotlumangoyloansliboleftleaderslaterlargerkaano-anoipinanganakindustriyaimbesibonshorthappenedmaliitgusting-gustoguiltyginaeksport,eksperimenteringeffektivtdisenyobuenababaarmedandroidadvanced1973parusangfeltlandpelikulamagsasalitapinalakingtawagpahiramprogramaperakikitamangangahoytumawagkonsentrasyonmakikipaglaroiiwasantumatawadalas-dosnakitulogtumatakbotabingnakapagreklamoculturadoesmakasilongnaguguluhangmakapagsabituluyanpagkaimpaktonagsasagotdraft,alaylilykaugnayanbundokklasengwinso-ordersalatinmusicianskulisapshoppingnapakorelevant2001graduallybreakstudiedoffentliglumakitumunogkasiyahanpagtinginsana-allsinasakyantaglagasuulaminmagtatanimmagtakakissisinakripisyonapapadaanmusicumangatiniresetamagtatakanaliligokutsaritangcoughingnakainbook,tiemposmaawaingmetodeferrerlightsmentalfuncioneswayskabibimaulitpatiarghchooseipinasyanganoresearch:interestcardroonsilayeditrobertallowednatingnakagawiangamitmedicalkindergartenoverallmaputlahigpitanbabasahinsiopaoendeligtinapayumiwasiniindanagpasanangkoplandasdemnagitlamakapaniwalamabihisanbusinessesnapasigawnagmadalingnararamdamannawalangbangladeshnagtrabahomurang-mura