Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "growth"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

3. Dedication to personal growth involves continuous learning and self-improvement.

4. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

5. Frustration can be a normal part of the learning process and can lead to personal growth and development.

6. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

7. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

8. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

9. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

10. Limitations can be viewed as opportunities for growth and personal development.

11. The CEO received a hefty bonus for successfully leading the company through a period of growth.

12. The company's growth strategy is focused on acquiring more assets.

13. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

14. Uncertainty can create opportunities for growth and development.

15. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

16. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

17. Work can also provide opportunities for personal and professional growth.

Random Sentences

1. Ang kanta ay isinulat ukol kay Alice na kaniyang sinisinta

2. Sumakay ako ng taksi papuntang airport.

3. Tinutukoy niya ang tarangkahan ng opisina kung saan sila magkikita.

4. Hindi minabuti ni Ogor ang kanyang pagsigaw.

5. La música que produjo el compositor fue muy innovadora para su época.

6. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

7. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

8. Nakatanggap si Nicolas ng sulat galing sa ninanais niyang paaralan, siya ay nakapasa dito.

9. Bilang paglilinaw, ang meeting ay hindi kanselado, kundi inilipat lang sa ibang petsa.

10. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

11. Umihip ang malamig na hangin, waring may paparating na masamang balita.

12. Sweetness is an important factor in the culinary arts and food industry.

13. Napakaganda ng mga pasyalan sa bansang Singapore.

14. Ang mga dentista ay may mga kagamitan na ginagamit upang masiguro na malinis at malusog ang mga ngipin.

15. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

16. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

17. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

18. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

19. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

20. Einstein was a member of the NAACP and spoke out against racism in the United States.

21. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

22. I always feel grateful for another year of life on my birthday.

23. Cada año, la cosecha de manzanas en esta región es muy buena.

24. Después de hacer ejercicio, me gusta darme una ducha caliente.

25. Samahan mo ako sa mall for 3hrs!

26. Oo malungkot din ako. Mamimiss kita.

27. Eh ayoko nga eh, sundae lang talaga gusto ko.

28. La agricultura sostenible busca minimizar el impacto ambiental del cultivo de alimentos.

29. Dogs can provide emotional support and comfort to people with mental health conditions.

30. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

31. Aray! nagcurve ball sya sa sakit sa sahig.

32. May malawak na lupain ang kanyang mga magulang.

33. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

34. Ang sampaguita ang pambansang bulaklak ng Pilipinas.

35. Napakabango ng sampaguita.

36. Ini sangat enak! - This is very delicious!

37. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

38. Ang pagbisita sa mga magagandang tanawin o pook turistiko ay isang nakagagamot na paraan upang mabawasan ang stress.

39. Kinuha nito ang isang magbubukid at agad na nilulon.

40. At blive kvinde kan også være en tid med forvirring og usikkerhed.

41. En invierno, se pueden ver hermosos paisajes cubiertos de nieve y montañas nevadas.

42. Ipagtimpla mo ng kape ang bisita.

43. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

44. Matagal nang hindi niya nabanggit ang pangalan ng kaibigan niya, kaya parang naglimot na siya rito.

45. Inilista ni Michael ang lahat ng maiingay sa klase.

46. Sa gabi ng handaan ay ipinatawag ng Ada ang lahat ng hayop at halaman.

47. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

48. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

49. Oh.. hindi ko alam ang sasabihin ko.

50. Sa aking silid-tulugan, natatanaw ko ang ganda ng buwan na sumisilay sa bintana.

Recent Searches

growthpasigawcharismaticiskedyulsundaelarongnogensindecapacidadlayawshopeebegansangkabosesarbejderblazingcapitalasakapeouetools,rhythmbilhinsagutinlatestmayopootkatabinghorseinspiredcondoproducirhannathanpromotingheisurgeryhatingaidestosratetabipopcornpaghihirapnakalilipasprodujotumatawagpahahanapnangangakomagkapatidestasyonnakataasinaabotautomatiskkumulogipinambilinagwikangbuwayatawananmagnifybobotoumaboginantayusacupidmaalogilanwaliscoatelections1980pagputibosesadvancedcomplicatedninarepresentedjohnguiltysaramakikitasinampalnakatirafar-reachingbatadahilalikabukinginugunitaaanhintatagalpronountuloy-tuloybitawanhighesthinihintayhalamansolmaibibigaymatangwatawattutusinmasaganangtaga-ochandopagdiriwangbayadlumipadkinabilangtelephonenabigaymaglakadhinalungkattiposaregladotanawretirarwednesdaydyanatensyoncocktailyatahappenedestilospagtangisprutasiconicosakaniyanremainonlinemininimizemestflashviewinteriorbirthdayhumahangoskusinanapapasayanagwelgatravelerpagpapakilalamaihaharapnotebookkabuntisandatapwatinilalabasdumagundongmaghahandamasayang-masayanakatagoakmangnagtaposlaylaykampanatumirahundredkumananmakapallumuwasmaibadalandangagamittataasunospangalanairconsakaysalatsinundangkagandamapahamakbusysumuotjokemaputitalehelpfulataquesprogramseithercreationincreasedpagkahapokarwahengmag-usappagkaimpaktomeriendanagtutulaknakakagalingpatutunguhannagmungkahijailhousetinulak-tulakmaipagmamalakingmumuntingnanlalamiggandahanmakuhangnagtalagakumidlat