Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "informed"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

3. Mathematics can be used to analyze data and make informed decisions.

4. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

5. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

Random Sentences

1. La película que produjo el estudio fue un gran éxito internacional.

2. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

3. Sa Sabado, alas-diyes ng umaga.

4. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

5. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

6. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

7. Nagsisilbi siya bilang chef upang magluto ng masarap na pagkain para sa kanyang mga kustomer.

8. Sa pagtulog, ang utak ay nagpapahinga at nagpaproseso ng mga impormasyon na natutunan sa buong araw.

9. No podemos negar la realidad, debemos aceptarla y adaptarnos a ella.

10. Ang laki ng bahay nila Michael.

11. The Great Wall of China is an impressive wonder of engineering and history.

12. Sa pagpanhik ng matanda sa burol ay bumuhos ang malakas na ulan, at yumanig ang lupa.

13. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

14. Ang kamalayan sa mga sintomas ng kalusugang pang-mental ay maaaring makatulong sa agaran at tamang pangangalaga.

15. Football is known for its intense rivalries and passionate fan culture.

16. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

17. Ngunit naglahong parang bula si Pinang.

18. Hindi dapat puro kababawan lang ang pinaguusapan ng mga tao, kailangan din ng mga seryosong usapan.

19. La salsa de chile es una de mis favoritas, me gusta el sabor picante.

20. Dogs can be trained for a variety of tasks, such as therapy and service animals.

21. Maari bang pagbigyan.

22. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

23. Si Apolinario Mabini ay kilalang bayani ng Pilipinas.

24. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

25. May problema ka ba? Kanina ka pa tulala eh..

26. Bakit ka nasa hospital?! Sorry kanina.

27. The team won a series of games, securing their spot in the playoffs.

28. Malamang na tamaan ka pa ng kidlat.

29. Fathers can be strong role models, providing guidance and support to their children.

30. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

31. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

32. Ako muna sabi, e, giit ni Ogor.

33. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

34. Ang aming angkan ay mayroong mga natatanging tula at awitin.

35. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

36. Limitations can be perceived or real, and they can vary from person to person.

37. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

38. Les personnes âgées peuvent être en bonne santé ou avoir des problèmes de santé.

39. Hindi namin mahanap ang tarangkahan ng bahay mo kaya't nag-text kami sa iyo.

40. Bumibili si Rico ng pantalon sa mall.

41. Ang paggamit ng mga apps at gadgets bago matulog ay maaaring makaapekto sa kalidad ng tulog ng isang tao.

42. Women have been leaders in social justice movements, such as the civil rights movement and the women's suffrage movement.

43. Durante la época renacentista, se desarrollaron las primeras formas de música instrumental, como la guitarra y el clavicémbalo

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

46. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

47. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

48. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

49. Las hojas de mi planta de menta huelen muy bien.

50. Nagtapos siya ng kolehiyo noong 1982.

Recent Searches

powersfourinformednerissasafevillageumigtadcharminghinimas-himasharibisigdiyanwastokalikasannagsasabingbuhokkayasamakatwidbukapagsubokberetipagkakatuwaanmakapalmamalasturorabonarailperlagawaeneroadversestudentbituinharpmagkaibaunitedtumahanpositibodisenyoipinadalaeasierbayawaknagtungomagkakagustomagbibiyahetaleinspirasyonnakabulagtanglaki-lakinaglinisculturalmakapagsabipinapasayanangangaralnagpipiknikluluwasnaguguluhangtumagalkumikilosmorningphilanthropynahihiyangnamumutladoble-karabesidestinaypinagawamagdamaganmasyadongnananalonginvestmakatulogbaoseryosongmagtagoinagawpaninigasenglishartistae-bookskahoybinge-watchingvedvarendenglalabanakisakaylolapagbibironatinagtasaescuelastusongarturomagalitunanhiramnaawananoodbiglaanmartianmatulunginawitinarabiaherramientaskatibayangturonofrecenkasalananproductsbulongrepublicanpaldanapapikitkargangtelefonnamainiintayaksidentepasensyasoundcharismaticdenneyeysupremetoretekinsetsesuotsoccerganadisposaldinibriefpartyumingitbagobalinggagambamayroongivereplacedbinibigaynapatakbopaycigarettesibaliktekstcardatentobroughttargetreportconsiderarelectroniclabanandaangkasinggandapulgadaganoonkumpletokasyakastilarelievedneverannatipostrainingbaldeformadebatessumamauuwingunitmitigateelectbilingkasingimpactednotebooksambitserviceskamatispinakidalapaglapastanganvaccinesfridaynanahimikmadungiswaterdalamatanggapcondorevisenagitlakaibamalapadsemillasbook,iniisipmag-ibakapitbahay