Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "home"

1. "A house is not a home without a dog."

2. Adopting a pet from a shelter can provide a loving home for an animal in need.

3. Cooking at home with fresh ingredients is an easy way to eat more healthily.

4. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

5. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

6. He forgot his wallet at home and therefore couldn't buy lunch.

7. He is watching a movie at home.

8. I forgot my phone at home and then it started raining. That just added insult to injury.

9. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

10. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

11. Nagtatrabaho ako sa Mimosa Family Home.

12. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

13. She exercises at home.

14. She missed several days of work due to pneumonia and needed to rest at home.

15. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

16. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

17. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

18. The team's colors are purple and gold, and they play their home games at the Staples Center.

19. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

20. There's no place like home.

Random Sentences

1. Los blogs y los vlogs son una forma popular de compartir información en línea.

2. Different types of work require different skills, education, and training.

3. Ipaliwanag ang mga sumusunod na salita.

4. Mens nogle mennesker kan tjene penge ved at gamble, er det en risikabel investering og kan ikke betragtes som en pålidelig indkomstkilde.

5. Pahiram ng iyong payong, mukhang uulan na mamaya.

6. Ang kanyang negosyo ay lumago nang husto, samakatuwid, nakapagbukas siya ng panibagong branch.

7. She has been exercising every day for a month.

8. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

9. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

10. El que busca, encuentra.

11. For eksempel kan vi nu tale med vores enheder og få dem til at udføre opgaver for os

12. We should have painted the house last year, but better late than never.

13. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

14. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

15. El perro de mi amigo es muy juguetón y siempre me hace reír.

16. Eine gute Gewissensentscheidung kann uns helfen, unser Leben in eine positive Richtung zu lenken.

17. Ang kuripot ng kanyang nanay.

18. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

19. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

20. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

21. Pakipuntahan mo si Maria sa kusina.

22. Dahil dito, walang may gustong makipagkaibigan sa kanya.

23. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

24. Bilang panghabambuhay na parusa ay pinamalagi ng Adang manatili sa labas ng Kasoy ang abuhing Buto nito.

25. Mga bopols! Tape lang hindi nyo pa nagawang makabili!

26. Mahalaga ang maagap na pagtugon sa pangamba upang maiwasan ang mas malaking panganib.

27. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

28. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

29. Pinatawad din naman ni Ana ang mga ito.

30. Si Apolinario Mabini ay kilalang bayani ng Pilipinas.

31. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

32. Dahil sa aksidente sa pagpapatakbo ng tren, ilang pasahero ang nagsusumamo para sa kanilang kaligtasan.

33. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

34. Libre ba si Carol sa Martes ng gabi?

35. Dapat tayong magpasya ayon sa tamang paninindigan at prinsipyo, samakatuwid.

36. Dumating na ang araw ng pasukan.

37. Frustration can be a normal part of the learning process and can lead to personal growth and development.

38. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

39. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

40. Matuto kang magtipid.

41. Puwede magdala ng radyo ang kaibigan ko.

42. There are so many coffee shops in this city, they're a dime a dozen.

43. Puwedeng gamitin ang pagguhit upang mag-disenyo ng mga damit at mga bagay-bagay.

44. Supreme Court, is responsible for interpreting laws

45. Sa tuwing nagkakasama kami, nadarama ko ang walang hanggang pagmamahal ng aking kabiyak.

46. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

47. Anong oras gumigising si Katie?

48.

49. He's always the first one in the office because he believes in the early bird gets the worm.

50. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

Similar Words

homeworkhomes

Recent Searches

wednesdaykulotrisehomeganitogrowthmaalwangbiyasnapapatinginmaatimasiacocktailkutsilyosensiblebisigpitosilbingarghorugaeffektivradiokaybarrocokantokailangangcomunicanoxygennagtataasunoeksenadevicesbulainterestdatapwatyanemailearlylibagrepresentedinternaipongpotentialsquatteribabaeducationalipinaobstaclestherengunithiningiarabiamabangispinakingganngumiwipagbabantaguiltybangosmestsystematiskexamhihigitpapelmorenakagayayumanigninongnapaaganapatawagguitarrapaumanhinbalingbusyangmulighedlamangreatahitsamfundbusogbukodencompassespangitpagdukwangkumaliwamatalinomahahanaynagkwentopinakamahabanakalipasnanlilisikcultivarmakapalnagtitiiskinakitaanmaipantawid-gutommagsasalitacallingnagpaalamnagsasagotclubmagpaliwanagmagasawangmangangahoybibisitamagkakailanakapasoksasamahanmanghikayatpinaghatidanpinag-aaralanbalitasakristanselebrasyonpansamantalaexhaustionnaiilagankasintahanbayawakihahatidbabasahinkamakailandeliciosamedisinalumayokuryentetumiraawtoritadongtagaytaymedicaldiwataencuestasmaliwanagpresidenteenviarnagtataekanginamag-isagawinkamandagmagtatanimnapakagandakinumutanpamumunosiguradomagsungitsinisirapakukuluanmagsisimulakumampinagbabalalumabaspagtatakatemperaturakarapatanghonestosiopaojosiesalaminpakakasalannagsamanalugodtelebisyonsikipgawainpisarahinagiskindergartenlunestanyagisasamaitinaobkassingulangvaliosapalantandaanlumiitumibigsarongmariemandirigmangtransportmaestraibabawunconstitutionalipinansasahogcommercialdeterminasyoniniisipkulangexpertisesilashoppinganubayanlayuanbopolstawapagkavelstandiniibigbalotnagpuntaipinasyang