Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "home"

1. "A house is not a home without a dog."

2. Adopting a pet from a shelter can provide a loving home for an animal in need.

3. Cooking at home with fresh ingredients is an easy way to eat more healthily.

4. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

5. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

6. He forgot his wallet at home and therefore couldn't buy lunch.

7. He is watching a movie at home.

8. I forgot my phone at home and then it started raining. That just added insult to injury.

9. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

10. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

11. Nagtatrabaho ako sa Mimosa Family Home.

12. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

13. She exercises at home.

14. She missed several days of work due to pneumonia and needed to rest at home.

15. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

16. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

17. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

18. The team's colors are purple and gold, and they play their home games at the Staples Center.

19. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

20. There's no place like home.

Random Sentences

1. The cake you made was absolutely delicious.

2. Ipinaluto ko sa nanay ko ang pansit.

3. Nag-aapuhap siya ng dispensa mula sa simbahan para sa kanyang mga nagawang kasalanan.

4. I always wake up early to study because I know the early bird gets the worm.

5. Ang maalikabok at baku-bakong lansangan ng Nueva Ecija ay kanyang dinaanan.

6. The credit card statement showed unauthorized charges, so I reported it to the bank.

7. El nuevo libro de la autora está llamando la atención de los lectores.

8. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

9. Ang presyo ng gulay sa palengke ay mababa ngayong linggo.

10. Wala kang pakelam! O sige its my turn na!

11. Lumiwanag ang paligid dahil sa paputok.

12. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

13. Pumasok ako sa klase kaninang umaga.

14. Natapakan ako ni Juliet habang sumasayaw.

15. Maari mo ba akong iguhit?

16. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

17. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

18. The restaurant bill came out to a hefty sum.

19. "Mahirap magtiis, pero mas mahirap ang walang tiis" ay isang bukambibig na nagpapahiwatig ng halaga ng pagtitiis sa mga pagsubok at paghihirap sa buhay.

20. If you're trying to convince me that he's a bad person, you're barking up the wrong tree.

21. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

22. Les jeux peuvent également dépendre de la chance, de la compétence ou d'une combinaison des deux.

23. Natawa na lang ako, Oo nga pala, ano nga ulit tanong mo?

24. Claro, puedes contar conmigo para lo que necesites.

25. Dahil sa iyong pagiging labis na madamot, kahit na marami ka namang pananim na maaring ibahagi sa iyong kapwa, ikaw ay aking paparusahan.

26. Inalalayan ko siya hanggang makarating sa abangan ng taxi.

27. Ikinagagalak kong malaman na natupad mo na ang iyong mga pangarap.

28. The United States has a system of government based on the principles of democracy and constitutionalism.

29. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

30. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

31. Si Ogor ang kinikilalang hari sa gripo.

32. Mahalaga na magpakatotoo ka sa mga taong bukas palad sa iyo upang mas maintindihan ka nila ng husto.

33. Sa tuwing nakikita ko ang aking kabiyak, nadarama ko ang kumpletong kaligayahan sa aking puso.

34. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

35. The cough syrup helped to alleviate the symptoms of pneumonia.

36. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

37. Sino-sino ang mga inimbita ninyo para manood?

38. Los adolescentes son especialmente vulnerables al uso de drogas debido a la presión social y la curiosidad.

39. Hindi dapat natin balewalain ang mga banta ng kalamidad, datapapwat ay hindi naman ito sigurado na magaganap.

40. Las vacaciones son una oportunidad perfecta para desconectar del trabajo.

41. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

42. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

43. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

44. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

45. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

46. Ang ganda talaga nya para syang artista.

47. May tatlong bituin ang watawat ng Pilipinas.

48. Masaya pa kami.. Masayang masaya.

49. I prefer to arrive early to job interviews because the early bird gets the worm.

50. Patuloy pa rin ang paghalik ng butiki sa lupa tuwing dapit-hapon.

Similar Words

homeworkhomes

Recent Searches

homekanayangnapakahabaaffecttinapayipinamilikutsilyomarilousandalingnahulogkumidlatnaiyakmakatatlonapakamotculturalfreemaisbigotecalciumhmmmmnilulonsarilingnagtatanongnakapagsabisalelumalakimakikipagbabagsundhedspleje,kumembut-kembotnag-replynag-iyakanmagkahawaknanghihinamadpagpapakalatpinagmamalakinakaka-innakikilalangnapakatalinonakaupoadvertising,kastilapaghahabitumunogpamasahekusineroactualidadsasakaypaghuhugasnapakakumirotpaghalikjuegosdaankaibamagpagalingtalebrasopinag-aralanclientespangyayarimemoryedwinnavigationtotoonamuhayevolucionadonangapatdanitinalagangmalambingstrategydaigdigkararatingdaystonehammabutingnakatirangsantohinagiseksport,matutongmusicanongdepartmentinfusionessumasakaykinalimutanchristmaswakastanggapindingnilangbroughtcomienzanbriefkablankainnakapasokspecialpromoteumuusiglenguajemalayongmonitorjustarbejdere-bookstools,diseasesgabrielkinseeffektivtsinakopeffektivayawinilingtinikgirlfriendtuwingkargangrabbahelpeddibabalangklasengituturopinagunti-untigrammarsinampalcasagranadalaylayteachpanguloumiinitschoolsextraarmediniintayuminommetodekarnabalcompletebackpuntamaisusuotthreesalu-salolinggonagpipiknikkapangyarihanvampiresikinakagaliteeeehhhhseguridadmalisanpagbigyanmanunulatkumikinigmeetingclienteabuhingrecibirbilingmatamansisentanapakamisteryosokakayanangmagtatagalnanlalamigkauntingmedievalangelicanilayuantinanongmaongproudinjurybulatekartonanimopalayomaawaminsanngunittamadnagpakilalakinamumuhianpresidentialrosabranchsapabeganprinceperobukodchadcallmadurastuwa