Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "rise"

1. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

2. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

3. The rise of digital currencies and payment systems is changing the way people use and think about money.

4. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

5. The sun does not rise in the west.

6. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

7. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

8. This has led to a rise in remote work and a shift towards a more flexible, digital economy

Random Sentences

1. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

2. Nilinis namin ang bahay kahapon.

3. I am absolutely thrilled about my upcoming vacation.

4. Sa gitna ng pagdidilim, mayroon pa ring mga tala na nakikita sa langit.

5. Nagalit ang matanda at pinalayas ang babaeng madungis.

6. Una buena conciencia nos da una sensación de paz y satisfacción.

7. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

8. "Mahal kita," ani ng binata sa dalagang kanyang nililigawan.

9. The legislative branch, represented by the US

10. Nanlaki ang mata ko saka ko siya hinampas sa noo.

11. Ha? Ano yung last na sinabi mo? May binulong ka eh.

12. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

13. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

14. Magbabakasyon kami sa Banawe sa tag-araw.

15. Tanggapin mo na lang ang katotohanan.

16. My grandma called me to wish me a happy birthday.

17. Bilang paglilinaw, ang event ay para sa lahat, hindi lang sa mga miyembro ng organisasyon.

18. All these years, I have been surrounded by people who believe in me.

19. Ang pagdadasal ng rosaryo tuwing alas-sais ng gabi ay isang ritwal na hindi nila kinalilimutan.

20. Ano-ano ang mga projects nila?

21. Hindi pa ako naliligo.

22. Gusto kong manood ng mga pambatang palabas.

23. She has been working in the garden all day.

24. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

25. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

26. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

27. ¡Buenas noches!

28. Ang mga kundiman ay nagpapahayag ng pighati at lungkot ng mga taong nagmamahalan.

29. Sino ang kasamang kumanta ni Katie?

30. Ano ang ginawa ni Tess noong Marso?

31. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

32. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

33. Es importante trabajar juntos para abordar la pobreza y promover un mundo más justo y equitativo.

34. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

35. Ang paggamit ng droga ay hindi lamang masamang bisyo, kundi pati na rin isang krimen laban sa iyong sarili at sa lipunan.

36. Sinubukan kong magpakilig sa aking nililigawan sa pamamagitan ng pagkanta ng isang love song.

37. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

38. Ang pagtulong at pagtutulungan ng mga komunidad ay mahalaga upang masiguro ang kaligtasan at pag-angat mula sa pinsala ng buhawi.

39. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

40. She is not drawing a picture at this moment.

41. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

42. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

43. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

44. Sang ayon si Jose sa suhestiyon ng kanyang kaibigan.

45. Pumunta ang pamilyang Garcia sa Pilipinas.

46. Ano ang nasa kanan ng bahay?

47. Samantalang ang ina naman, si Magda, siyang nag-aasikaso sa kanilang bahay at dalawang anak na sna Maria at Jose

48. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

49. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

50. Many people start their day with a cup of coffee to help them wake up and feel more alert.

Similar Words

Fundrise

Recent Searches

limitedrisecompositoreslistahankabuhayankasakitproudklasengipapamanalendbinulongtaassoccermournedhomesblusamartesmansanasgagelectoraldibamagkasinggandamatindingadditionoverallmaalogfeltproperlymalagoginanglordandamingsearchsinunodputahekumarimotmalapitproduciragoslulusogfatideyaoutposthalladverselybugtongmaunawaanpiyanogayunpamantuwingasignaturagardenmaibibigayimpityonuminomdollarauthorcheforderfeelingdrawingconectanpdamainitfiguresdayilangkapilingexamplegitaraintelligenceayaninangatpackagingmakingwebsiteconsidermeresummitlargercornerfencingkusinerokumainospitalisamashowpinakamagalingwaripinalayascorapananimdedicationipanlinismakakawawamarurumimalakasbilhanpangyayarinobodysabitusongnakikiadumilimimpactomalihismangepinagwikaankawayanlangostalikesmuchasdahanraymondkaninaspeednahuliyounglangmemorianagsisilbivaliosatiniklingtoolimpactedmitigateprogrammingnapagtantotravelmagtataasnapanoodnagpabotnaghuhumindignakayukoreadinginakalanglumikhaenfermedades,kumembut-kembotmakakuhaniyangmakikiraannangangahoynagbakasyonnapakatalinonakagalawpinagtagponakakatawakasawiang-paladnakakapagpatibaypossiblemag-aaraldumagundongturismonananalonagpabayadmaihaharappalabuy-laboymeriendanagtatanongmag-plantre-reviewalapaaphanapbuhaykolehiyonagpalutoskyldes,magsugalnalamanmakakabaliknakakainbrancher,pahiramlumuwaslalakadpangungusapnakabawipaki-chargekumaenmahabangnakitulogorasanalas-dostumigilfysik,masasabipagtatakapeksmanrektanggulodahilmagsabiumagangmagisipbilibidsiyudadlungsodtelecomunicacionesnahigitantig-bebeinte