Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "research:"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

5. Cancer research and innovation have led to advances in treatment and early detection.

6. Einstein's legacy continues to inspire and influence scientific research today.

7. Hiram na libro ang ginamit ko para sa aking research paper.

8. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

9. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

10. Investing in the stock market can be risky if you don’t do your research.

11. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

12. Microscopes are commonly used in scientific research, medicine, and education.

13. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

16. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

17. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

18. Research and analysis are important factors to consider when making investment decisions.

19. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

20. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

21. Scientific research has led to the development of life-saving medical treatments and technologies.

22. Scientific research has shown that meditation can have a positive impact on mental health.

23. Scientific research has shown that regular exercise can improve heart health.

24. She donated a significant amount to a charitable organization for cancer research.

25. Stock market investing carries risks and requires careful research and analysis.

26. The news might be biased, so take it with a grain of salt and do your own research.

27. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

28. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

2. Les sciences de la Terre étudient la composition et les processus de la Terre.

3. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

4. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

5. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

6. Limitations can impact one's career, relationships, and overall quality of life.

7. Nangyari ang isang insidente na nagdulot ng takot sa kanya, kaya't nais niyang maglimot na lang tungkol sa pangyayaring iyon.

8. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

9. Eh? Katulad ko? Ano ba ang isang tulad ko?

10. Saan pupunta si Trina sa Oktubre?

11. Iniuwi ni Rabona ang pusang iyon.

12. Ang pagkakaroon ng tamang kaalaman at kakayahan ay makakatulong upang maibsan ang pangamba.

13. Nakipaglaro si Liza ng saranggola sa kanyang mga pinsan.

14. Sana hinde na lang ako nagloko. Sana naniwala na lang ako.

15. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

16. El que busca, encuentra.

17. Pagtatanim at pagbebenta ng gulay ang kinabubuhay ng magasawang Waldo at Busyang na parehong masipag at mabait.

18. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

19. Sa ganang iyo, sapat na ba ang ginawa niya upang maitama ang kanyang pagkakamali?

20. Nasa harap ng bangko ang bus stop.

21. Nous avons décidé de nous marier cet été.

22. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

23. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

24. May galak na sumusuno sa kanyang dibdib habang pinagmamasdan ang pagkapuno ng sinundang balde.

25. Padabog akong umupo habang dumadating na yung order nya.

26. Limitations can be cultural or societal, such as gender roles or stereotypes.

27. Nang tayo'y pinagtagpo.

28. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

29. Inisip niya kung ano ang kasuutan nito na maaari niyang pagkakilanlan, ang tabas ng mukha, ang gupit, ang tindig.

30.

31. Nagkagulo sa palengke at kumaripas ng takbo ang mga tao dahil sa maling akalang may sunog.

32. Emphasis can also be used to create a sense of urgency or importance.

33. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

34. Siembra las semillas en un lugar protegido durante los primeros días, ya que el maíz es sensible al frío

35. La pobreza extrema puede llevar a la inseguridad alimentaria y la desnutrición.

36. Ang taong na-suway sa kautusan ay maaaring pagmultahin o parusahan.

37. Kucing di Indonesia juga terkenal dengan sifatnya yang suka tidur dan bermalas-malasan.

38. Nous avons besoin de plus de lait pour faire cette recette.

39. Hinanap niya ang dalaga sa buong kagubatan ngunit hindi niya nakita.

40. Kailangan kong lumakas ang aking loob upang maalis ang aking mga agam-agam sa aking mga pangarap.

41. Ano ang gusto mo, sinigang o adobo?

42. Nanggaling ako sa loob ng sinehan at napakadilim ng paligid dahil sa matinding liwanag sa loob.

43. The novel was a hefty read, with over 800 pages.

44. Cancer can impact not only the individual but also their families and caregivers.

45. Isang araw, ang katulong ng bagong Sultan ay humahangos at ibinalitang may isang punongkahoy na tumubo sa kinalilibingan ni Sultan Barabas.

46. Morgenstund hat Gold im Mund.

47. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

48. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

49. Puwede paki-ulit ang sinabi mo?

50. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

Recent Searches

research:pitootrasmataposchartspaki-translatenakatayodalipinagtagpotinulak-tulakbaku-bakongbagoinformedandhinatidpagdukwangminu-minutohubad-barobiologikaibigannakataasmagdamagannami-missespanyangendviderenamungaencuestasalitaptapenchantedgivermagbigayanconstantlydilimemocioneseksportenekonomiyadistansyadistanciadisfrutarpagkaangatpinakidalapagdudugolumakidisenyongdisciplindireksyondevelopededucationaldescargardependingpumatoldemocracybukasdelegateddecisionsdalawampudadalawincualquiercountriescomunicancompaniesyeymaonghelpedlayuanmanilacommunitycoaching:eksport,ngipinclassroomunconstitutionalunanhinagislumiitnakakapagpatibayclassmatecellphonecassandracandidatecampaignsmakaratingkwebalaryngitissoccerbuung-buobusiness:business,busabusinbumabalotsagutinbroadcastalas-diyesbloggers,bisikletabinulabogbinitiwanbinigyangbinibigaybinabaratbinabalikmalapalasyobeginningfanspresyobasketbolcasamangingisdatinitirhaninilingleadingipantalopbarcelonacallibinigaybaranggaybahagyangbabayaranfindimpactpanguloumiinitpulanagsinebabasahinavailableautomaticatensyongarbularyoaraw-arawalmacenartindahanmakapangyarihangsino-sinoalexandervidenskabalbularyoanotherutak-biyaaktibistaunti-untiaksidenteaccederbipolartusindvisdyanmarketingairplanestumingalaagam-agamtangekstumatakboanalyseaffiliatetumalikodadverselytumahimikmalapadtrainingtomorrowkampeonpaghamaksinuotmakawalaonlytradebabaerobutikinaglabananmangiyak-ngiyakpatuloyonline,pinag-usapankumarimotmakikiligothemlabahinthreekinabubuhayhinalungkathitikwhileroqueleadbetakilofrescobahalamignapakabagalcompostnakapanghihinamartaabrilsumakitaffectboxmaatimritatigas