Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "being"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

3. Amazon has a reputation for being innovative and forward-thinking.

4. Amazon's customer service is known for being responsive and helpful.

5. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

6. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

7. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

8. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

9. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

10. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

11. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

12. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

13. His speech emphasized the importance of being charitable in thought and action.

14. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

15. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

16. Lazada has faced criticism over counterfeit products being sold on its platform.

17. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

18. Mathematics is an ever-evolving field with new discoveries and applications being made constantly.

19. Regular exercise and playtime are important for a dog's physical and mental well-being.

20. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

21. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

22. The management of money is an important skill that can impact a person's financial well-being.

23. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

24. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

25. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

26. You're not being direct. Stop beating around the bush and just say it.

Random Sentences

1. Nakapila ako sa bayad center upang magbayad ng kuryente.

2. Ah opo, ngayon ko lang napagtanto ng sinabi nya yun.

3. Limitations can be addressed through education, advocacy, and policy changes.

4. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

5. El agua es esencial para la vida en la Tierra.

6. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

7. Kung hindi ngayon, kailan pa ang tamang panahon?

8. Inakyat ng bata ang puno at tinikman ang bunga.

9. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

10. Ikinagagalak kong makita kang masaya sa bagong kabanata ng iyong buhay.

11. Naisip nilang tinangka ng kanilang anak na sunugin ang kanilang bahay.

12. Nasisilaw siya sa araw.

13. Hindi siya nag-aral para sa pagsusulit, samakatuwid, bumagsak siya.

14. Isang Saglit lang po.

15. Naghihirap na ang mga tao.

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. Sandali na lang.

18. Pinilit niyang itago ang kanyang naghihinagpis upang hindi mag-alala ang kanyang pamilya.

19. Efter fødslen skal både mor og baby have grundig lægeundersøgelse for at sikre deres sundhed.

20. Nagbuwis ng buhay ang ilang bayaning pilipino makamit lang ang araw ng kalayaan.

21. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

22. A couple of coworkers joined me for lunch at the cafe.

23. Ang kanyang ama ay isang magaling na albularyo.

24. Limitations can be a source of motivation to push oneself to achieve more.

25. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

26. Ano ang ipinabalik mo sa waiter?

27. Mahusay mag drawing si John.

28. Gusto ko sanang makabili ng bahay.

29. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

30. Umingit ang sahig ng kanilang barungbarong nang siya'y pumasok.

31. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

32. Los héroes defienden la justicia y luchan por los derechos de los demás.

33. Nakatira si Nerissa sa Long Island.

34. Maaf, saya tidak mengerti. - Sorry, I don't understand.

35. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

36. Abs yan!! Tingnan mo nga oh! May mga guhit guhit!

37. Hinawakan niya iyon sa magkabilang tirante.

38. Television has also had a profound impact on advertising

39. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kita ligawan?

40. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

41. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

42. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

43. Malaya na ang ibon sa hawla.

44. Ang haba na ng buhok mo!

45. Ang daming tao sa peryahan.

46. Naiinggit ako sa ibang hayop at halaman na tuwang-tuwa kapag may handaan sa kagubatan.

47.

48. Di ko inakalang sisikat ka.

49. Las personas pobres a menudo tienen que trabajar en condiciones peligrosas y sin protección laboral.

50. Ano ang mga apelyido ng mga lola mo?

Recent Searches

bringbeingsaginggrabestatuslagilotconcernsnilulonsoremang-aawittinaasanpetsabaryosinampalkakilalapanindatumagalsisikatmorningaddmatustusansumangactualidadpaghuhugaspetsidopaboritongkumaripashumalakhakhimbrancher,maskisipangrocerypisipaninigasaccuracyhabitssultanmedidacutenglandtuluyanfencingbrasoinfinitybiyernesapatnapuamaorugaandresmaiingayumiinitaccederdagabuenashortpinyaloanspitocupidbusiness,diagnosticneveruniquebiniliipapainitkartoninterpretingdaddykilodonekanangsumabogpalancanaghuhumindigtravelisulatbiologimensajesgagawinnapakalakingbinibiyayaancruztaostumamismagsisimulapagtatakapatakbojejunanunuksolondonkastilapaakyatpaliparinhinilaitinaobpormarangalumiwassakalingcarbonunibersidadbosesbeginninglaruanlandgodtkaarawantalenttiningnaninakyatbuntismarangyangkamustacardiganpagiisipnaglahosaan-saanpinagawatangeksnananalongmaliwanagpinakidalanalakisilyapalakatinitindapa-dayagonalathenaexperts,aguatayoaregladonakatuwaangpagkakalutonagmakaawaobra-maestraikinasasabikmagkakagustogobernadormagbabakasyonfacultymarchantbarung-barongpunongkahoynangagsipagkantahancaracterizafulfillmentlibertyisusuottinatanongperyahanpinalalayaspinangalananmahabangnagliliwanagnaiwanganungarabiabunutanmagdilimisuborenaialagaslaskusinaibinibigayipatuloyadangmakaratinganaycomputere,tshirtflaviomembersayokonagbalikmostmusicsutiltransitdesdeourfonoresearchspendinghamakmatanghigh-definitionincludeusingattackrangejunjunipinalutosetsgisingsampunguusapan