Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "artist"

1. Batman, a skilled detective and martial artist, fights crime in Gotham City.

2. Black Widow is a highly skilled spy and martial artist.

3. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

4. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

5. Maraming mga artist ang nakakakuha ng inspirasyon sa pamamagitan ng pagguhit.

6. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

7. The artist painted a series of landscapes inspired by her travels.

8. The artist's intricate painting was admired by many.

Random Sentences

1. Les travailleurs indépendants travaillent souvent à leur propre compte.

2. The uncertainty surrounding the new policy has caused confusion among the employees.

3. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

4. Der er ingen fastlagte regler for, hvordan man bliver kvinde, det er en individuel proces.

5. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

6. She is practicing yoga for relaxation.

7. El deportista produjo un gran esfuerzo para ganar la competencia.

8. Kilala si Marites bilang isang tsismosa sa kanilang baranggay.

9. Oo nga, yung last time eh nung birthday ko pa. ani Genna.

10. We have been walking for hours.

11. La tos puede ser tratada con medicamentos, como jarabes para la tos y expectorantes.

12. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

13. Einstein's brain was preserved for scientific study after his death in 1955.

14. Ginagamit ang salitang "waring" upang ipahiwatig ang isang hinuha o tila isang bagay na maaaring totoo, ngunit hindi pa tiyak.

15. Las redes sociales son una parte fundamental de la cultura digital actual.

16. The weather was bad, and therefore the game was cancelled.

17. Kapag umuulan, hindi puwedeng maglaba ng mga damit sa labas.

18. To: Beast Yung friend kong si Mica.

19. Mas magaling siya kaysa sa kanya.

20. Sa paligsahan, pumasok sa entablado ang mga kalahok nang limahan.

21. Kami ay pabalik na diyan sa kaharian, pasensiya na sa masamang balita.

22. Obvious. tawa nanaman sya ng tawa.

23. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

24. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

25. May meeting daw ang lahat ng guro kaya't kami ay maagang pinauwi.

26. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

27. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

28. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

29. Mabuti pang makatulog na.

30. Sa facebook kami nagkakilala.

31. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang matuto at magpamalas ng kanilang kakayahan.

32. Bago niya napanalunan ang ginto, si Hidilyn Diaz ay nagwagi na ng pilak na medalya sa Rio Olympics 2016.

33. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

34. Napakahalaga ng pag-unlad ng mga pagsasaliksik sa talambuhay ni Apolinario dela Cruz bilang isang relihiyosong lider.

35. The early bird catches the worm.

36. Il est important de savoir gérer son argent pour éviter les problèmes financiers.

37. Dadalaw ako kay Lola Sela bukas.

38. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

39. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

40. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

41. Ang paggamit ng droga ay maaaring magdulot ng pagkakaroon ng mga karamdaman, tulad ng mga sakit sa puso, kanser, at mga problema sa paghinga.

42. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

43. Inflation kann auch durch eine Erhöhung der Steuern verursacht werden.

44. Hindi naman, kararating ko lang din.

45. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

46. Nous avons choisi une chanson spéciale pour notre première danse.

47. Nationalism has been used to mobilize people in times of war and crisis.

48. Parang ganun na nga babes. Tapos tumawa kami.

49. Einstein was married twice and had three children.

50. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

Similar Words

artistaartistasartists

Recent Searches

diwatainaaminartistmatagumpaypaidika-12kumampiamuyinnagdalanaiiniskapekarwahengnagmamadaliditotenderpagongnalangiligtasnilaossusunodkinakainnangingisayarturomartianperseverance,panunuksorimasgloriatulongvaledictorianibinalitanganitopumatolcarolpresleylimitedpuwedelumulusobmonetizingkalikasankaalamanmakilalawatchingkwebangstarbaird1000sakinfiabobonagpanggappiecesmakasarilingtoretenagbasaencompassesdietskypepresyomanunulatmisteryomoredividesbirobrucebileripipilittrainingrolejunioleftentermultocontinueusingtechnologicalhimisinulatmakatulogs-sorrykumaintennismagsugalnagsilapitkastilangressourcernekartongcruzmagisipeksport,nagbentanagdudumalingbarongpalibhasasikrer,pinakamalapitgawinmongkumapitalaganglacsamananakabawigymsinkdollarmarilounaispagkaestarmagpuntadinitiposformakinagatdahilconectadossourcesbluereservationroofstockbernardomatalinobumangonhalamangpanalanginpwedemaipantawid-gutominnovationkailangannalalaglagnegosyonapatingintodoaraw-arawknowsexpresanmedidaaminkuryentemagkababataulongkakapanoodnagmungkahisaritanapagtantonakatitigaga-agakapintasangpakukuluanhulingbinibilikalayaanpaaralanawitanninyongcomputermabutibutoilagaysurroundingskulangdikyampaligsahangustosemillaslagisumindihislayawlearningpagsisimbangbalancesestilosactingnaiinggititinuringrestawanekonomiyalolaemphasizedmessagedoingmukhamusicianhulitinahakkuligliglangkay1950spaki-bukasinuulamedsapalangsagoteroplanosumasagotvelfungerendemaskivotesmanamis-namis